SecReT6
Protein ID: 189353354
SecReT6 ID289
T6SS typei3
Gene symbol-
Locus tagBMULJ_04594
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome II [GenBank: NC_010805] [Browse all T6SS(s) in this replicon]
Location [Strand]1600324..1600863 [-]
Producthypothetical protein
NoteTssB
UniProt IDA9APY7
KEGG IDbmu:Bmul_3907, bmj:BMULJ_04594
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.40E-60, Aligned region: 10..164
Protein Sequence: 179 a.a.     [Download]
>gi|189353354|ref|YP_001948981.1| hypothetical protein BMULJ_04594 [Burkholderia multivorans ATCC 17616]
MSASNSQKFIARNRAPRVQIEYDVEVYGSEKKVELPFVMGVLADLSGKHPVEPLPAVSERRFLEIDIDNF
DERMKAIRPRVAFAVPNTLTGEGQMMVDMTFESMEDFSPAAIADKVEPLRRLLQARTQLANLQTYMDGKS
GAEALVTQLLQDPALLKSLAAAPRSERHEADAADSANAS
 
Nucleotide Sequence: 540 bp     [Download]
>gi|189351978|ref|NC_010805.1|:c1600863-1600324 Burkholderia multivorans ATCC 17616 chromosome 2, complete genome
ATGTCCGCTAGCAATTCGCAGAAGTTCATCGCGCGCAATCGTGCGCCGCGTGTGCAGATCGAGTACGACG
TCGAAGTGTATGGCTCGGAGAAGAAAGTCGAGCTTCCGTTCGTGATGGGCGTACTTGCCGACCTCTCCGG
CAAGCATCCGGTCGAGCCGCTGCCGGCGGTGTCCGAGCGCCGGTTTCTGGAAATCGACATCGACAACTTC
GACGAGCGCATGAAGGCGATCCGGCCGCGCGTCGCGTTTGCCGTGCCGAATACGCTGACGGGCGAAGGCC
AGATGATGGTCGACATGACCTTCGAAAGCATGGAGGACTTCTCGCCGGCCGCGATCGCCGACAAGGTCGA
GCCGCTGCGCCGCCTGCTCCAGGCGCGTACGCAGCTGGCGAACCTGCAGACGTACATGGACGGCAAGTCG
GGCGCCGAGGCGCTCGTCACCCAGCTGCTGCAGGACCCGGCGCTGCTGAAGTCGCTGGCTGCGGCGCCGC
GGTCGGAGCGGCACGAAGCGGACGCGGCCGATTCCGCCAACGCGAGCTGA