SecReT6
Protein ID: 189353358
SecReT6 ID289
T6SS typei3
Gene symbol-
Locus tagBMULJ_04598
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome II [GenBank: NC_010805] [Browse all T6SS(s) in this replicon]
Location [Strand]1605476..1607365 [+]
Producthypothetical protein
NoteTssF
UniProt IDA9APY3
KEGG IDbmj:BMULJ_04598, bmu:Bmul_3903
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.90E-219, Aligned region: 5..629
Protein Sequence: 629 a.a.     [Download]
>gi|189353358|ref|YP_001948985.1| hypothetical protein BMULJ_04598 [Burkholderia multivorans ATCC 17616]
MDPRLLDYYNQELIYMRELAAEFAHAHPKIARRLGMQAGEVADPYVERLIESFSFMAARMQLKLDAEFPR
FTERLLEVIYPNYVAPTPSISIARLYPGQTEGSLVDGYRLPRGTTFTAQVPDGERTACRFTSGQDVTLWP
LAITDARLTGIPPDIPALARYSAPDTPVRGALRIRLATTGNVRIADLKGLDRLPVYLAGDEQVASHLFEL
LHAGAIASVIGAPGEFGRPGRSPAAVTERAVEHEGLGTDQSLLPLNWAKFHGHNLLHEYFACPARFWFFA
LNGLAEGFSRIDGREVEIVVLLDRAPGPLANLVDASRFALFCTPVVNLFRKHTDRVEISPRDTEFHLVPA
RLTPLDYEVFSVSAVYGQVAATSSELEFRPLYQTLNNDEGNHGRYFSVRRERRLLSDSARRYGTRTPYVG
TEVFLSLVDQAEAPYGENIRFLSVDALLTNRDLATLVPRDGVRDLETAQSAPVDSIGLIRPPSAPLPPYA
ERETAWRLIRQLNFDHLPLEALDHREGGQGLRDLLRLYLVDGDSGQSRQVESLVGAKTRPVTRKLPGTGP
MTFGRGIECTLTVDETGFSGVSPYLFGTILEHWLARHVSINSFTQTELHSMQRGRIARWPARTGTRGVL
 
Nucleotide Sequence: 1890 bp     [Download]
>gi|189351978|ref|NC_010805.1|:1605476-1607365 Burkholderia multivorans ATCC 17616 chromosome 2, complete genome
ATGGACCCGCGACTGCTCGACTACTACAACCAGGAACTCATCTACATGCGCGAGCTCGCCGCCGAGTTCG
CACATGCGCATCCGAAGATCGCGCGTCGGCTCGGCATGCAGGCCGGCGAGGTGGCGGACCCGTATGTCGA
GCGCCTGATCGAATCGTTCAGCTTCATGGCCGCGCGCATGCAGCTCAAGCTCGATGCAGAATTTCCGCGC
TTCACGGAACGGCTGCTCGAGGTCATCTATCCGAACTACGTCGCGCCGACGCCGTCGATCTCGATCGCCC
GGCTGTACCCCGGACAGACCGAAGGCAGCCTCGTCGACGGCTATCGCCTCCCGCGCGGCACCACGTTCAC
GGCGCAGGTTCCCGACGGCGAGCGCACGGCCTGCCGGTTCACGAGCGGACAGGACGTCACGCTGTGGCCG
CTCGCGATCACCGACGCGCGGCTGACCGGCATTCCACCGGATATCCCCGCGCTCGCGCGCTATAGCGCGC
CCGATACACCCGTGCGCGGCGCGCTGCGAATCAGGCTCGCGACCACCGGCAACGTGCGGATCGCCGACCT
GAAAGGACTCGACCGGCTCCCGGTCTATCTGGCAGGCGACGAACAGGTCGCGTCGCATCTGTTCGAATTG
CTGCATGCGGGCGCGATCGCCTCGGTCATCGGCGCACCGGGCGAATTCGGCAGGCCCGGCCGCTCACCGG
CGGCCGTCACCGAACGCGCGGTCGAACACGAGGGGCTGGGCACCGATCAAAGCCTGCTGCCGCTGAACTG
GGCCAAGTTCCACGGGCACAATCTGCTGCACGAGTACTTTGCCTGCCCCGCGCGCTTCTGGTTCTTCGCG
TTGAACGGCCTCGCCGAAGGGTTCTCGCGCATCGACGGCCGGGAAGTCGAGATCGTCGTGCTGCTCGACC
GTGCGCCGGGGCCGCTCGCCAATCTCGTCGATGCGTCGCGCTTCGCGCTCTTCTGTACGCCCGTCGTCAA
CCTGTTCCGCAAGCACACCGACCGCGTCGAGATTTCGCCGCGCGATACCGAATTCCATCTGGTTCCGGCT
CGGCTCACGCCGCTCGACTACGAGGTGTTCTCGGTCAGCGCCGTCTACGGTCAGGTTGCCGCCACGTCGT
CCGAGCTCGAATTCCGGCCGCTCTATCAGACGCTGAACAACGACGAAGGCAATCACGGCCGCTATTTTTC
GGTGCGGCGCGAACGGCGGCTGCTGTCCGATTCGGCGCGCCGCTACGGCACACGCACGCCGTACGTGGGA
ACGGAAGTGTTTCTCTCGCTCGTCGACCAGGCCGAGGCGCCGTATGGCGAAAACATCCGCTTCCTGTCGG
TCGACGCGCTATTGACGAACCGCGATCTCGCCACGCTCGTGCCGCGCGACGGCGTGCGCGACCTCGAGAC
CGCGCAATCCGCGCCGGTCGACAGCATCGGTCTGATCCGGCCGCCGAGCGCACCGTTGCCGCCGTATGCC
GAGCGGGAAACGGCATGGCGTCTGATCCGCCAGCTGAACTTCGACCATCTGCCGCTCGAGGCGCTCGATC
ACCGCGAAGGCGGGCAAGGCCTGCGCGACCTGCTGCGCCTGTATCTCGTGGATGGCGACTCCGGGCAAAG
CCGGCAGGTCGAAAGCCTCGTCGGCGCGAAAACGCGCCCCGTGACGCGCAAGCTGCCGGGAACCGGCCCG
ATGACCTTCGGCCGCGGCATCGAATGCACGCTGACGGTCGACGAGACAGGCTTCTCGGGCGTGAGCCCCT
ATCTTTTCGGCACGATCCTCGAACACTGGCTCGCGCGCCACGTGTCGATCAACAGCTTCACGCAGACGGA
GCTGCATTCGATGCAACGCGGCCGGATCGCGCGCTGGCCGGCGCGCACCGGCACGCGCGGAGTGCTGTGA