SecReT6
Protein ID: 189353359
SecReT6 ID289
T6SS typei3
Gene symbol-
Locus tagBMULJ_04599
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome II [GenBank: NC_010805] [Browse all T6SS(s) in this replicon]
Location [Strand]1607365..1608438 [+]
Producthypothetical protein
NoteTssG
UniProt IDB3D8E3
KEGG IDbmu:Bmul_3902, bmj:BMULJ_04599
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.10E-104, Aligned region: 25..325
Protein Sequence: 357 a.a.     [Download]
>gi|189353359|ref|YP_001948986.1| hypothetical protein BMULJ_04599 [Burkholderia multivorans ATCC 17616]
MQRAALPEPLRDHALSAELLDALLAEPWRFGFLSLMRRIGTNAALDPIGTARRPQAEPFRLGQQPSLAFA
PREIASAHETAGQLKVRLFGLGMLGPNGPLPIHVTEIARDRESSRRDTTTVDFFDIFHHRFFTLFYRAWA
SAQAAAGLDRKHREQFSFYVASLIGHELGEIERRPLPSHARLAASAHLIRESRNPDGLRATLEHYFGVPV
AVVENVFHWIEIDLADCGRMGYPGAAATMGRGAVLGRVAPDRQHRFRIVIGPVDLDAYLRFTPQGEDLPR
LVEWVRAFVGRELEWELELRIQPESAPPAVMGGRQRLGWSGWLGRPAPDKPITGMRFQPERHPRHFNRRH
TDSGHRA
 
Nucleotide Sequence: 1074 bp     [Download]
>gi|189351978|ref|NC_010805.1|:1607365-1608438 Burkholderia multivorans ATCC 17616 chromosome 2, complete genome
ATGCAGCGCGCCGCGCTTCCCGAACCGCTGCGCGATCACGCGCTGTCGGCGGAACTGCTCGACGCCCTGC
TGGCCGAGCCCTGGCGTTTCGGCTTCCTGTCGTTGATGCGGCGGATCGGCACGAACGCCGCACTCGATCC
GATCGGCACCGCGCGCCGCCCGCAGGCCGAACCGTTCCGACTGGGCCAGCAGCCGAGCCTGGCGTTCGCA
CCGCGGGAAATCGCGAGCGCGCACGAAACGGCCGGGCAGCTCAAGGTGCGGCTGTTCGGCCTCGGCATGC
TCGGGCCCAACGGCCCGCTGCCCATCCACGTGACGGAAATCGCGAGGGATCGGGAAAGCAGCCGCCGCGA
TACGACCACGGTCGACTTCTTCGACATCTTCCATCACCGGTTCTTCACGCTGTTCTATCGTGCGTGGGCC
TCCGCACAGGCGGCTGCGGGCCTCGACCGCAAACACCGCGAACAGTTCTCGTTCTATGTCGCCAGCCTGA
TCGGGCACGAGCTCGGCGAGATCGAACGGCGCCCCCTTCCGTCGCATGCGCGCCTGGCCGCCTCGGCCCA
TCTCATTCGCGAATCGCGCAATCCGGACGGGCTGCGCGCGACGCTCGAGCATTATTTCGGCGTCCCGGTG
GCGGTGGTGGAAAACGTCTTTCACTGGATCGAAATCGATCTGGCCGACTGCGGGCGCATGGGCTATCCGG
GCGCCGCCGCGACGATGGGCCGCGGCGCCGTGCTCGGACGCGTCGCCCCCGACCGCCAGCACCGATTCCG
CATCGTGATCGGCCCCGTCGATCTCGACGCATACCTGCGCTTCACGCCGCAGGGCGAAGACCTGCCACGG
CTCGTCGAGTGGGTGCGCGCCTTCGTCGGTCGCGAGCTCGAATGGGAACTCGAGCTGCGCATCCAACCCG
AGAGCGCGCCGCCGGCCGTGATGGGCGGCCGCCAGCGCTTGGGCTGGTCCGGCTGGCTGGGCCGGCCCGC
ACCCGACAAGCCGATCACCGGCATGCGCTTCCAGCCCGAACGCCATCCACGCCACTTCAATCGCCGCCAT
ACGGATTCCGGACATCGAGCATGA