SecReT6
Protein ID: 189353360
SecReT6 ID289
T6SS typei3
Gene symbol-
Locus tagBMULJ_04600
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome II [GenBank: NC_010805] [Browse all T6SS(s) in this replicon]
Location [Strand]1608435..1609553 [+]
ProductImpA-like protein
NoteTssA
UniProt IDA9APY1
KEGG IDbmj:BMULJ_04600, bmu:Bmul_3901
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.80E-22, Aligned region: 71..130
Protein Sequence: 372 a.a.     [Download]
>gi|189353360|ref|YP_001948987.1| ImpA-like protein [Burkholderia multivorans ATCC 17616]
MSRKSSTTPNRAGRAAVADTPHENWLAPLSESAPCGPDLEYDHDFVVLFAGTTPRQDVQYGGFVGSPEPL
NWSEIERDCRRLMGRTKDIRVAVLYARCRTRLAGVEGLAEGTGLLAGWLQAFPEQVHPRADIDDDRHAAL
EMRMNALQALADPEGLLADVREIVLTRSTAARLQVRDVERAFAHPRPIDALAPDSVALQLQNLREQQPST
MKAFDDAIANLCAIDAWCATHLETSLPDFSPLVRLLRLFQVGDAPGGTRSDTLPSAEREECEAPVPPVFG
DAPSAPPRVDDAQTAAPASTSVAAPASLAPTDRQAALALICAARRWFETHEPSSPIPVLLARAEQFVGKR
YVDVVKAIPAELLAQWEAADGS
 
Nucleotide Sequence: 1119 bp     [Download]
>gi|189351978|ref|NC_010805.1|:1608435-1609553 Burkholderia multivorans ATCC 17616 chromosome 2, complete genome
ATGAGCAGGAAATCGTCCACCACGCCAAACAGGGCCGGCCGCGCAGCCGTCGCCGATACGCCGCACGAGA
ACTGGCTCGCGCCGTTGAGCGAGTCGGCGCCGTGCGGCCCCGATCTCGAATACGACCACGATTTCGTCGT
GCTGTTTGCCGGCACCACGCCGAGACAGGACGTGCAATACGGTGGCTTCGTCGGTTCGCCCGAGCCGCTG
AACTGGAGCGAGATCGAGCGAGACTGCCGGCGGCTGATGGGGCGGACGAAGGACATACGCGTCGCCGTGC
TGTATGCGCGCTGTCGCACGCGCCTGGCCGGCGTGGAAGGTCTTGCGGAGGGAACGGGGCTATTGGCGGG
CTGGTTGCAGGCATTTCCGGAGCAGGTGCATCCACGGGCCGATATCGACGACGATCGCCATGCCGCGTTG
GAAATGCGGATGAACGCGCTGCAAGCGCTGGCGGATCCGGAAGGCCTGCTGGCCGACGTGCGGGAAATCG
TCCTGACGCGATCGACGGCCGCCCGGCTGCAGGTACGCGACGTCGAGCGTGCGTTCGCGCATCCGCGACC
GATCGATGCGCTCGCACCCGACTCGGTCGCGCTGCAGTTGCAGAACCTGCGCGAACAGCAACCGTCGACG
ATGAAGGCCTTCGACGACGCGATCGCGAATCTCTGTGCCATCGATGCGTGGTGCGCGACGCATCTCGAAA
CGTCGCTGCCGGATTTTTCCCCGCTGGTCCGCCTGCTTCGGCTCTTTCAGGTCGGCGACGCGCCGGGCGG
CACGCGGTCCGACACCTTGCCTTCGGCCGAGCGCGAGGAATGCGAGGCGCCGGTGCCGCCGGTGTTCGGC
GACGCGCCTTCTGCCCCGCCCCGTGTGGACGACGCGCAAACGGCTGCGCCCGCTTCGACGTCCGTCGCCG
CGCCCGCTTCGCTCGCGCCGACAGACCGGCAGGCAGCGCTGGCGTTGATCTGCGCGGCACGCCGCTGGTT
CGAGACGCACGAACCAAGCAGCCCCATTCCGGTGCTGCTCGCACGCGCCGAACAATTCGTCGGAAAGCGC
TATGTCGATGTCGTCAAGGCGATTCCGGCGGAACTGCTCGCTCAATGGGAAGCGGCAGACGGATCATGA