SecReT6
Protein ID: 190894177
SecReT6 ID290
T6SS typei3
Gene symbol-
Locus tagRHECIAT_PB0000210
StrainRhizobium etli CIAT 652
Repliconplasmid pB [GenBank: NC_010996] [Browse all T6SS(s) in this replicon]
Location [Strand]221483..223510 [-]
Producthypothetical protein
NoteTssI
UniProt IDB3Q2L5
KEGG IDrec:RHECIAT_PB0000210
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.20E-63, Aligned region: 36..355
Phage_GPD [PF05954], Evalue: 7.20E-63, Aligned region: 519..553
Phage_base_V [PF04717], Evalue: 1.30E-24, Aligned region: 425..518
Protein Sequence: 675 a.a.     [Download]
>gi|190894177|ref|YP_001984471.1| hypothetical protein RHECIAT_PB0000210 [Rhizobium etli CIAT 652]
MVESRIESLLRHNRFVAVTSAASELNEISLRRLSGTERLGEPFLYEVKLASRNPVQNFATIPGQNLTIGL
KLKDSQTRFFNGVVTRFQYLGLDDTEHLNYVAQVRPWISLLEHRSNSRVFQNKTSIEIITTIFREHKGNF
KNQTARRFPQRPYCVQYDETDLAFVSRLMEQDGIYYYFEHAEDQHDLVLVDNAASHMACTPEIVETHHNL
RPARSLYQEDVILHWDEVVSLQPNKVVLRDYDHEKPMAELTSVARVPPVRTGGIPPCKLTGSAITRPRES
VAVRTGETSSASSGCTAMREVFEYPGQYTKKSDGDFYATIRAEELACNAYRARIESTARQITTGSLFKAA
NPFYYGQVGSRPKPTDRFLAVGQDFTVIGEVGDDLTADTVGGKGERFLYHSNVEIIPATTQYRPRRRTPA
RLIHGPQTAVVVGPEGESIATDKYGRVKVQFFWDREGGKNENSSCWIRVAQNFAGKGFGNLVVPRIGHEV
VVDFIHGNPDTPLVTGVVYNGSNLPPETLPTDKTRSTFRTHTDGGAANAYNELRFEDKQGREEVYLKAQK
NHTVEVGNIYSIDVKRHFLLTSGGAAPDSPAAAALGSRVEVTPDKIRLVVSGRTGPQAIEISGDGIAIIG
TMIGVMATPPRLGSIVSMPPPTPGPPTPSIMKLIATLGLPPVTPE
 
Nucleotide Sequence: 2028 bp     [Download]
>gi|190893983|ref|NC_010996.1|:c223510-221483 Rhizobium etli CIAT 652 plasmid pB, complete sequence
ATGGTCGAGTCAAGAATCGAGAGTCTCTTAAGGCACAATCGTTTTGTTGCGGTCACTTCGGCCGCGTCCG
AGTTGAATGAAATCTCTCTCCGGCGGCTCAGTGGCACCGAGCGGCTGGGGGAACCTTTCCTCTACGAGGT
GAAGCTCGCCAGCCGCAATCCAGTTCAGAACTTTGCTACGATCCCCGGTCAAAACCTGACAATCGGCCTT
AAGCTCAAGGACTCGCAAACGCGCTTCTTCAACGGTGTTGTTACGCGCTTCCAATATCTCGGCCTCGACG
ATACCGAGCACCTCAACTACGTGGCGCAGGTGCGGCCGTGGATTTCATTGCTCGAGCATCGCTCTAACAG
TCGGGTCTTTCAGAACAAGACGAGCATCGAGATCATCACCACGATTTTTCGAGAACATAAAGGCAATTTC
AAGAATCAGACCGCCCGACGGTTCCCACAGCGCCCATATTGCGTCCAGTACGATGAAACGGATCTGGCCT
TCGTCAGCCGCCTCATGGAGCAGGACGGCATCTACTACTATTTTGAACATGCTGAGGACCAACATGACCT
GGTGCTGGTCGACAACGCCGCGAGTCACATGGCCTGCACGCCTGAGATCGTAGAGACCCACCACAATCTC
AGGCCTGCCCGAAGTCTTTACCAAGAAGATGTCATCCTGCATTGGGACGAGGTCGTATCGCTACAGCCGA
ACAAGGTCGTTCTCAGGGACTATGACCATGAGAAGCCGATGGCAGAACTGACGTCTGTCGCGCGTGTTCC
TCCCGTGAGGACAGGCGGCATTCCGCCATGCAAGCTCACGGGAAGCGCCATCACCCGACCGCGGGAGAGC
GTGGCGGTCAGAACGGGCGAGACCTCGTCGGCAAGCAGCGGCTGCACGGCAATGCGGGAGGTCTTCGAGT
ATCCAGGCCAGTATACAAAAAAAAGCGATGGCGATTTCTACGCCACCATCCGTGCCGAGGAACTCGCCTG
CAACGCTTATCGCGCGCGGATCGAAAGCACTGCGCGCCAGATAACGACCGGGTCATTATTCAAGGCGGCA
AATCCCTTCTACTACGGCCAGGTCGGTTCCCGCCCGAAACCCACCGATCGCTTTCTGGCAGTCGGACAGG
ACTTCACTGTCATCGGTGAGGTGGGGGACGATCTCACTGCGGACACCGTGGGGGGGAAGGGCGAGCGGTT
CCTCTATCACAGCAACGTAGAGATTATCCCCGCGACAACCCAGTACCGACCGAGGCGCCGCACACCGGCG
CGGTTGATTCACGGACCGCAGACGGCCGTCGTCGTGGGCCCCGAGGGCGAGTCGATCGCGACGGATAAGT
ACGGCCGTGTGAAGGTTCAGTTCTTCTGGGACCGAGAAGGCGGAAAGAACGAGAACAGCTCCTGCTGGAT
TCGGGTGGCCCAGAACTTCGCTGGTAAGGGTTTTGGCAACCTGGTCGTCCCACGGATCGGCCATGAGGTC
GTGGTTGATTTCATCCACGGCAATCCCGACACGCCCCTGGTGACCGGCGTCGTATACAATGGCTCAAATC
TGCCGCCTGAAACCCTGCCGACCGACAAAACGCGGTCGACCTTCCGGACGCATACCGATGGCGGCGCCGC
TAATGCCTACAATGAACTGCGCTTTGAGGACAAGCAGGGCCGTGAGGAGGTCTATTTGAAGGCCCAGAAG
AATCATACCGTCGAGGTCGGGAATATCTACAGCATCGACGTCAAGAGACACTTCCTCCTGACCTCGGGCG
GCGCCGCGCCCGACTCCCCTGCCGCAGCGGCCTTAGGTAGCCGCGTCGAGGTAACACCCGACAAGATCCG
CCTTGTAGTATCGGGCAGAACCGGCCCGCAGGCCATCGAAATCAGCGGCGATGGGATCGCCATTATCGGC
ACGATGATTGGCGTTATGGCAACACCTCCGCGGCTCGGGTCCATCGTCTCCATGCCGCCGCCGACACCGG
GTCCACCCACGCCGTCGATAATGAAGCTTATTGCGACACTCGGGCTGCCGCCTGTTACGCCCGAGTGA