SecReT6
Protein ID: 190894178
SecReT6 ID290
T6SS typei3
Gene symbol-
Locus tagRHECIAT_PB0000211
StrainRhizobium etli CIAT 652
Repliconplasmid pB [GenBank: NC_010996] [Browse all T6SS(s) in this replicon]
Location [Strand]224048..225241 [-]
Producthypothetical protein
NoteTssG
UniProt IDB3Q2L6
KEGG IDrec:RHECIAT_PB0000211
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.30E-98, Aligned region: 14..318
Protein Sequence: 397 a.a.     [Download]
>gi|190894178|ref|YP_001984472.1| hypothetical protein RHECIAT_PB0000211 [Rhizobium etli CIAT 652]
MISGALGDFLSSLRAEPHACDFFQALRRIDAICSDRPRLGESSGPSLDRVRIAQQPSLAFPTRSIAGVTA
HEENDPVISTYAFGLFGPHGPLPLHLTEYALLRQHNAADETLIRFADTFHHRMASFFFRAWAEGEPTVSY
DRPQEDRFALQLGALAGFGMTSLRARDAMPDLAKLHFTGRLASHTRNAEGLAAILASFVEAPVDIREFVP
KWVDLPRISLCLLGRDPATGTLNSNAIAGARVRVWHHRFRLIVGPLSLAHYESLLPAAPGLKSIAEIICN
YLGDELDWEINLVLRQEQVPEVQLGRCGRLGWSSWMGKRKTRQHADDLTTTPTDRDPPAAAWRSPETDIH
DAAGPLDLLFGRGEDLLGEIDLERVNGPRNLDTKCGGTAGGGLEGPL
 
Nucleotide Sequence: 1194 bp     [Download]
>gi|190893983|ref|NC_010996.1|:c225241-224048 Rhizobium etli CIAT 652 plasmid pB, complete sequence
TTGATTTCGGGGGCACTCGGCGACTTCCTAAGCTCGCTCAGGGCCGAACCGCATGCCTGCGACTTCTTCC
AGGCTCTGCGGCGGATCGATGCAATCTGCTCAGATCGGCCTCGGCTGGGAGAATCGAGCGGTCCCAGCCT
GGATCGCGTGCGGATCGCCCAGCAGCCCTCCCTTGCATTTCCGACTCGATCGATCGCGGGCGTGACTGCG
CACGAGGAGAACGACCCCGTAATCTCCACCTACGCCTTCGGCTTGTTTGGACCCCACGGTCCCCTCCCAT
TGCATCTGACGGAGTACGCCCTTCTCCGGCAGCACAACGCCGCGGATGAGACGCTGATCCGATTTGCTGA
TACCTTTCATCATCGAATGGCCTCGTTCTTCTTCCGCGCATGGGCGGAGGGCGAACCGACCGTGAGCTAT
GACAGGCCACAAGAAGATCGATTTGCCCTTCAGCTCGGCGCGCTAGCCGGCTTCGGGATGACCTCCCTGC
GCGCGCGGGATGCTATGCCTGATCTGGCCAAACTCCACTTCACCGGCCGTCTCGCCTCACACACCCGCAA
CGCCGAGGGGCTCGCTGCCATCCTCGCCAGCTTCGTCGAGGCGCCGGTTGATATCCGTGAATTTGTCCCA
AAGTGGGTGGATCTGCCCCGCATATCGCTCTGCCTCCTGGGCCGCGACCCGGCCACGGGCACGCTGAACA
GCAACGCTATTGCAGGTGCGAGGGTCAGAGTGTGGCACCATCGGTTCCGACTCATTGTGGGTCCCCTCAG
CCTGGCTCATTACGAATCGCTTCTGCCCGCAGCTCCCGGCCTTAAGTCGATAGCGGAGATCATCTGCAAC
TACCTTGGAGATGAACTTGACTGGGAGATTAACCTCGTTCTCCGTCAGGAGCAGGTCCCGGAAGTGCAGT
TGGGTCGCTGCGGCAGACTCGGATGGTCCAGTTGGATGGGCAAGAGGAAAACGCGCCAGCACGCCGATGA
CTTGACAACTACCCCGACTGACCGGGACCCACCGGCTGCCGCATGGCGCTCTCCTGAAACGGACATCCAT
GATGCGGCGGGCCCGCTCGACCTTCTTTTCGGGCGGGGAGAAGATCTCCTTGGCGAGATCGATCTGGAAC
GGGTGAATGGCCCACGTAACCTCGATACCAAGTGCGGCGGCACGGCGGGCGGCGGCTTGGAAGGCCCGTT
ATGA