SecReT6
Protein ID: 190894179
SecReT6 ID290
T6SS typei3
Gene symbol-
Locus tagRHECIAT_PB0000212
StrainRhizobium etli CIAT 652
Repliconplasmid pB [GenBank: NC_010996] [Browse all T6SS(s) in this replicon]
Location [Strand]225238..227124 [-]
Producthypothetical protein
NoteTssF
UniProt IDB3Q2L7
KEGG IDrec:RHECIAT_PB0000212
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 4.40E-203, Aligned region: 5..628
Protein Sequence: 628 a.a.     [Download]
>gi|190894179|ref|YP_001984473.1| hypothetical protein RHECIAT_PB0000212 [Rhizobium etli CIAT 652]
MDPRLLRLYNDELAYMREMGAEFARAFPKVAARLGMESAEVADPYVERLLEGFAFMAARVQLKLQSRFPE
FTQHLLEMVYPHFLPPLPSMTIVRFEPDQDAGRLENGYLVPRGTKLLGRLAPGAVTHCEFRTAHDVHLWP
IVVSAADYFSTPGQIAALDLPARQDAKAALRLRLRTTNGMPFNKLGLEALTLHLTGPGGIGAALAEQLLG
DACNIIARPVGRPIPWQEKIPVHALQQRGLEPSCALLPEVPRSFDGYRLLQEYFALAERTLFVEVSGLAD
AVALSTAETLEIVFALRRVEPRLERQLGPQNIVLFATPAINLFERQADLVHVSDKNTEHHVIVDRMRPLD
FEVHSILEMSGDGAKNEAAPVRFYPFYSISAHGQEEQHSRYYAIRREQRLMSEHQRLNGARTGYIGSETF
VSLVDRQAAPYSAELRHLSVNCLCSNRDLALLLPIGRDETDFTLEIGAPVTATRCVSPPSRPRHSFANGD
ITWRLISHLSLNYLSISNSDRNDHRGAEALRELLRLYVDPVNAFASRQIDGIREIRSRPAVRRLSSGGQA
AVARGIEVGIILDEAAFEGVGIFPLASVLNQFFAKYVSINSFTEMVVSTLQRGEVMRWPTMAGRRAIL
 
Nucleotide Sequence: 1887 bp     [Download]
>gi|190893983|ref|NC_010996.1|:c227124-225238 Rhizobium etli CIAT 652 plasmid pB, complete sequence
ATGGATCCCCGGCTCCTGCGACTGTACAACGACGAACTTGCTTATATGCGCGAGATGGGGGCCGAGTTCG
CCCGTGCATTCCCGAAGGTCGCCGCCCGGCTCGGGATGGAATCAGCGGAGGTCGCCGACCCCTACGTCGA
GCGGCTTCTGGAAGGCTTCGCTTTCATGGCGGCGCGGGTGCAATTGAAGCTTCAGTCTCGCTTTCCGGAA
TTCACCCAGCACCTCCTGGAGATGGTCTATCCGCATTTTCTACCGCCGCTCCCCTCGATGACGATCGTCC
GTTTCGAGCCCGACCAGGATGCCGGACGACTTGAAAATGGATACCTCGTGCCGCGGGGAACCAAGCTTTT
GGGCCGTCTTGCTCCGGGCGCCGTCACACATTGCGAGTTCCGCACGGCCCATGATGTGCATCTCTGGCCA
ATTGTGGTGAGCGCTGCCGATTATTTTTCGACGCCGGGGCAGATCGCCGCACTGGATCTTCCGGCCCGGC
AAGATGCGAAGGCTGCTTTGCGACTACGCCTTCGCACCACCAATGGCATGCCGTTCAATAAACTCGGACT
AGAGGCTCTCACACTGCACCTAACAGGCCCCGGTGGCATCGGCGCCGCACTCGCCGAACAGCTTCTCGGT
GACGCATGCAATATCATAGCCCGTCCGGTCGGCCGGCCTATCCCTTGGCAGGAAAAGATTCCGGTTCATG
CGCTGCAGCAACGCGGTTTGGAGCCGAGCTGTGCTCTCCTGCCCGAGGTGCCACGCTCTTTCGACGGGTA
CCGTCTCCTACAGGAGTATTTCGCCCTCGCGGAGCGGACGTTGTTCGTCGAGGTTAGCGGGCTGGCAGAC
GCAGTAGCCCTGTCAACTGCCGAGACCCTTGAGATCGTCTTCGCACTCAGACGTGTCGAGCCACGGCTGG
AACGACAGCTCGGGCCCCAAAATATCGTTCTCTTCGCAACGCCCGCGATTAATCTCTTCGAACGCCAGGC
AGATCTCGTCCACGTGAGCGACAAGAACACCGAGCATCATGTGATTGTTGACAGGATGAGGCCGCTCGAC
TTTGAGGTCCACTCGATCCTCGAGATGAGCGGAGACGGGGCGAAAAACGAAGCGGCTCCCGTGAGGTTCT
ACCCGTTCTATAGCATCAGCGCGCACGGTCAGGAGGAGCAGCATTCCAGATACTACGCGATCCGCCGGGA
GCAGCGCCTCATGTCGGAGCACCAGCGTCTAAATGGCGCGCGGACTGGCTACATCGGCAGCGAAACGTTC
GTTTCTCTAGTTGATCGCCAGGCGGCTCCCTATTCGGCGGAACTCCGGCATTTGTCTGTAAACTGCCTGT
GCTCGAACCGGGATCTGGCGCTGCTGCTGCCGATCGGCCGGGACGAGACAGACTTCACCCTGGAAATCGG
CGCTCCAGTTACCGCCACCCGGTGCGTATCGCCCCCGAGCCGACCGCGCCACTCCTTCGCCAATGGCGAT
ATCACTTGGCGATTAATTAGCCATCTTTCACTGAACTACCTCTCGATCAGCAATTCCGATAGGAACGACC
ACCGGGGCGCAGAAGCGCTACGTGAACTCCTCCGCCTCTACGTCGATCCAGTCAATGCCTTCGCCTCACG
GCAGATCGACGGGATCCGGGAGATTCGGTCCAGGCCTGCGGTCAGGCGATTGTCCAGCGGTGGACAAGCC
GCCGTAGCACGTGGGATTGAGGTTGGTATCATCCTGGACGAAGCGGCCTTCGAAGGCGTTGGCATCTTTC
CGCTCGCCTCCGTGCTCAACCAGTTCTTCGCGAAATACGTATCCATCAACAGCTTCACCGAGATGGTCGT
CTCGACGCTACAGCGCGGGGAGGTAATGCGATGGCCGACGATGGCCGGCCGCCGGGCGATCCTTTGA