SecReT6
Protein ID: 190894180
SecReT6 ID290
T6SS typei3
Gene symbol-
Locus tagRHECIAT_PB0000213
StrainRhizobium etli CIAT 652
Repliconplasmid pB [GenBank: NC_010996] [Browse all T6SS(s) in this replicon]
Location [Strand]227124..227627 [-]
Producthypothetical protein
NoteTssE
UniProt IDB3Q2L8
KEGG IDrec:RHECIAT_PB0000213
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 5.10E-18, Aligned region: 37..145
Protein Sequence: 167 a.a.     [Download]
>gi|190894180|ref|YP_001984474.1| hypothetical protein RHECIAT_PB0000213 [Rhizobium etli CIAT 652]
MGRDVKRDLVQPSLLDRLTDDEPRSSCEAQDKRSFSVRQLEEVILRDVSWLLNTNQLGATVDLQAYPHVA
ASALNYGAWPLSGQIREGMDKSALREAIIESLQRFEPRLLPDTLKVTVLDDGQGCGTFRFRIEADLWAQP
LPVRMVMRTEVDSELESARVHLGTEIS
 
Nucleotide Sequence: 504 bp     [Download]
>gi|190893983|ref|NC_010996.1|:c227627-227124 Rhizobium etli CIAT 652 plasmid pB, complete sequence
ATGGGCAGAGATGTTAAGCGGGATCTCGTGCAACCATCCCTCCTGGACCGGCTTACGGACGATGAGCCGC
GCAGCTCGTGTGAAGCGCAGGACAAGCGCAGCTTCTCTGTTCGCCAACTGGAAGAGGTGATTCTACGCGA
TGTTTCCTGGTTGTTGAACACCAATCAATTGGGTGCAACCGTAGATCTACAAGCGTACCCTCACGTAGCG
GCCAGTGCACTTAATTATGGTGCCTGGCCTCTCAGCGGACAAATTCGCGAAGGCATGGATAAGAGCGCAT
TGCGCGAAGCGATAATCGAGAGCCTTCAGCGCTTTGAGCCGCGTCTCTTACCGGACACCCTGAAGGTCAC
GGTCCTGGACGATGGTCAGGGTTGCGGCACTTTTCGCTTTAGGATCGAAGCCGATCTGTGGGCGCAGCCA
TTGCCGGTGCGAATGGTGATGCGTACGGAGGTAGATTCCGAGCTCGAATCCGCCCGCGTTCATCTCGGTA
CAGAGATAAGCTGA