SecReT6
Protein ID: 190894181
SecReT6 ID290
T6SS typei3
Gene symbol-
Locus tagRHECIAT_PB0000214
StrainRhizobium etli CIAT 652
Repliconplasmid pB [GenBank: NC_010996] [Browse all T6SS(s) in this replicon]
Location [Strand]227714..228247 [-]
Producthypothetical protein
NoteTssD
UniProt IDB3Q2L9
KEGG IDrec:RHECIAT_PB0000214
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.70E-19, Aligned region: 34..146
Protein Sequence: 177 a.a.     [Download]
>gi|190894181|ref|YP_001984475.1| hypothetical protein RHECIAT_PB0000214 [Rhizobium etli CIAT 652]
MAFDAVIKFTQASKDGILPKGESIILKDGITLADEWSFSLENKLNIGPHTAGAGAGKAEFEVFTIKKQVD
TSSPSLYVACGRGAHFNSVELKLFKATGSGQATSESNLFLHWSFNMLVVEKVEWSYAEEAPEETITFRFG
ACKVIYYRQDEKGALTKAGEGIWNQIANSTDFNRLVG
 
Nucleotide Sequence: 534 bp     [Download]
>gi|190893983|ref|NC_010996.1|:c228247-227714 Rhizobium etli CIAT 652 plasmid pB, complete sequence
ATGGCGTTCGACGCGGTTATAAAATTCACGCAAGCGTCCAAGGACGGCATTTTGCCCAAGGGCGAATCTA
TCATTCTAAAGGACGGTATCACCCTAGCGGACGAATGGAGCTTTTCACTCGAAAACAAGCTGAACATTGG
GCCTCATACCGCCGGGGCGGGCGCGGGCAAGGCCGAATTCGAGGTCTTCACTATCAAGAAGCAGGTGGAT
ACGTCATCGCCCTCTCTGTACGTTGCCTGTGGTCGCGGCGCCCACTTCAATAGCGTCGAACTGAAACTTT
TCAAAGCGACGGGGAGCGGACAAGCTACATCAGAATCGAACCTGTTCTTGCACTGGAGTTTCAACATGCT
GGTAGTCGAGAAGGTCGAGTGGTCCTATGCGGAAGAGGCCCCCGAGGAGACGATCACATTCCGGTTCGGC
GCCTGCAAGGTCATTTATTACAGGCAGGATGAAAAAGGCGCTCTTACCAAAGCTGGCGAGGGCATCTGGA
ACCAAATCGCGAACAGCACCGACTTCAATAGGCTCGTCGGCTGA