SecReT6
Protein ID: 190894182
SecReT6 ID290
T6SS typei3
Gene symbol-
Locus tagRHECIAT_PB0000215
StrainRhizobium etli CIAT 652
Repliconplasmid pB [GenBank: NC_010996] [Browse all T6SS(s) in this replicon]
Location [Strand]228363..229850 [-]
Producthypothetical protein
NoteTssC
UniProt IDB3Q2M0
KEGG IDrec:RHECIAT_PB0000215
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.70E-185, Aligned region: 64..490
Protein Sequence: 495 a.a.     [Download]
>gi|190894182|ref|YP_001984476.1| hypothetical protein RHECIAT_PB0000215 [Rhizobium etli CIAT 652]
MMPADATDVQVATVDLGDFTRMLRFEFKIRSDHSRDLVESAVRTLAEQALQNTSLISDDVVTTIQAMIAS
IDQKLSAQLNEILHHENFQRVESAWRGLHHLAINTETDETLKIRVLPVSKVEMSRTLRKYKGVTWDQSPL
FKKIYEDEYGQIGGEPYGCLIADYYFDHTPPDVELLSGLAQIAAASHSPLISAVSPHLLQMDSWRELANP
RDITKIFLTPEHAPWRAFRESENSRYVALTLPRTLGRLPYGAKTNPVDEFAFEEDTDGGDSEKYLWTNAA
YAMGVNITRSFKLYGWLSRIRGVESGGLVEGLPVHTFRSDDGGVDLKCPTEIAISDRREAELSKNGLLPL
LHRKNTDLGVFIGAQTINKPVKYEDPDASANAELSARLPYIFATCRFAHYLKCMVRDKIGTFKERHEVEE
WLNQWIQGYVHPSPELGSEESKAQQPLSSAEVKVEEVEDNPGYYVARFYMRPHYQLEGLTISLRLVSRLP
SARKD
 
Nucleotide Sequence: 1488 bp     [Download]
>gi|190893983|ref|NC_010996.1|:c229850-228363 Rhizobium etli CIAT 652 plasmid pB, complete sequence
ATGATGCCTGCAGATGCCACAGATGTACAGGTCGCCACCGTTGATCTCGGCGATTTCACCCGCATGCTTC
GATTCGAGTTCAAGATCCGCTCGGACCACTCCCGTGACTTGGTGGAGAGTGCCGTCCGAACACTGGCCGA
GCAGGCACTTCAAAACACGTCGCTGATCAGCGACGATGTCGTCACGACTATCCAAGCAATGATTGCTTCG
ATCGACCAGAAGCTTTCTGCACAACTCAACGAGATCCTCCATCACGAAAATTTCCAGCGCGTGGAATCAG
CTTGGCGGGGCTTGCATCACCTTGCCATCAACACCGAAACCGATGAAACGTTGAAGATTCGCGTTCTCCC
AGTTTCAAAGGTGGAGATGTCCCGAACTCTGCGGAAATATAAGGGTGTCACCTGGGATCAGAGTCCGCTA
TTCAAAAAAATTTACGAAGACGAATACGGCCAAATCGGCGGTGAACCCTATGGCTGCCTGATTGCCGACT
ACTATTTCGACCATACCCCACCGGACGTAGAGTTGCTTTCGGGACTGGCGCAGATCGCGGCGGCGAGCCA
CTCACCGCTTATATCTGCCGTCTCACCACATCTGCTGCAGATGGATTCTTGGCGTGAGCTTGCGAACCCG
CGTGACATCACAAAAATCTTCCTCACGCCCGAACATGCCCCTTGGCGGGCGTTCCGCGAGAGCGAGAACT
CTCGGTACGTGGCCCTGACCTTACCACGCACCCTTGGCCGGCTGCCCTACGGGGCCAAAACCAACCCGGT
CGATGAATTCGCCTTCGAGGAGGACACAGACGGCGGCGACAGCGAGAAATACCTTTGGACGAACGCAGCC
TACGCCATGGGCGTAAATATCACGCGCTCGTTCAAGCTCTATGGCTGGCTCTCCAGAATTCGTGGCGTCG
AATCCGGCGGCCTGGTCGAGGGTCTGCCGGTACATACCTTCCGCAGCGACGACGGTGGCGTCGACCTAAA
ATGCCCCACTGAGATCGCGATCAGCGACCGCCGTGAGGCCGAACTGTCCAAAAACGGTCTTCTACCGCTG
TTGCACCGCAAAAACACGGACCTCGGCGTATTTATTGGCGCTCAAACTATTAACAAGCCGGTCAAATACG
AAGACCCCGACGCGTCAGCGAACGCCGAACTCAGTGCCCGGCTACCCTACATCTTCGCAACCTGCCGCTT
CGCACATTATTTGAAGTGTATGGTCCGGGACAAGATTGGCACGTTCAAGGAGCGCCACGAGGTCGAGGAG
TGGCTCAACCAATGGATTCAGGGCTATGTCCACCCCTCGCCCGAGCTTGGGAGCGAAGAGAGTAAGGCAC
AGCAGCCGCTCTCCTCAGCCGAGGTCAAGGTGGAAGAGGTCGAAGATAATCCCGGATATTACGTTGCGAG
ATTTTACATGCGGCCACACTACCAGCTCGAAGGCCTAACCATCTCTTTGAGACTTGTCTCGCGCCTGCCA
TCCGCCCGCAAGGACTGA