SecReT6
Protein ID: 190894183
SecReT6 ID290
T6SS typei3
Gene symbol-
Locus tagRHECIAT_PB0000216
StrainRhizobium etli CIAT 652
Repliconplasmid pB [GenBank: NC_010996] [Browse all T6SS(s) in this replicon]
Location [Strand]229853..230407 [-]
Producthypothetical protein
NoteTssB
UniProt IDB3Q2M1
KEGG IDrec:RHECIAT_PB0000216
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.10E-55, Aligned region: 10..162
Protein Sequence: 184 a.a.     [Download]
>gi|190894183|ref|YP_001984477.1| hypothetical protein RHECIAT_PB0000216 [Rhizobium etli CIAT 652]
MTKASSQKFIARVRPPRVQIEYDVETYGSQKKVQLPFVVGVMSDLAGNAAEPLAPVAERKMMEIDIDNFD
DRLRSLRPRVVMRVPNLLTGEGQLAVDLTFERLEDFSPAAVARKVDSLSRLLEARTELSNLLAYMDGKNG
AEELLTHFLADSALLSALGNGIETEKPDAVVAAPPLASPDTEEN
 
Nucleotide Sequence: 555 bp     [Download]
>gi|190893983|ref|NC_010996.1|:c230407-229853 Rhizobium etli CIAT 652 plasmid pB, complete sequence
ATGACAAAGGCGAGTAGTCAAAAGTTCATCGCGCGGGTTCGTCCGCCTCGCGTACAGATCGAATACGACG
TCGAGACCTATGGCTCTCAGAAGAAGGTTCAGCTTCCCTTCGTGGTCGGCGTGATGTCCGACCTCGCCGG
CAATGCTGCCGAGCCGCTTGCCCCTGTCGCGGAGCGCAAGATGATGGAGATCGATATCGACAATTTCGAT
GATCGGCTCAGATCGCTGAGGCCCAGGGTGGTGATGCGGGTGCCGAACCTATTGACCGGAGAAGGCCAAC
TCGCTGTCGACTTGACGTTCGAGCGGCTCGAAGATTTCTCGCCGGCGGCCGTGGCGCGCAAGGTCGACAG
CCTTAGCAGGCTGCTCGAGGCGCGAACGGAGCTCTCCAATCTGCTGGCCTATATGGACGGGAAGAACGGT
GCCGAAGAGTTGCTCACCCACTTCCTCGCGGATTCGGCACTGCTAAGCGCCCTCGGCAATGGCATCGAGA
CTGAGAAGCCTGATGCAGTGGTTGCCGCTCCGCCATTGGCATCCCCAGACACAGAGGAGAACTGA