SecReT6
Protein ID: 190894184
SecReT6 ID290
T6SS typei3
Gene symbol-
Locus tagRHECIAT_PB0000217
StrainRhizobium etli CIAT 652
Repliconplasmid pB [GenBank: NC_010996] [Browse all T6SS(s) in this replicon]
Location [Strand]230443..231435 [-]
Producthypothetical protein
NoteTssA
UniProt IDB3Q2M2
KEGG IDrec:RHECIAT_PB0000217
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.00E-18, Aligned region: 53..113
ImpA-rel_N [PF06812], Evalue: 5.00E-18, Aligned region: 226..233
Protein Sequence: 330 a.a.     [Download]
>gi|190894184|ref|YP_001984478.1| hypothetical protein RHECIAT_PB0000217 [Rhizobium etli CIAT 652]
MLDADHLLKPISDGNACGDALDYDLSFLELEIASHGKPHQQIGDSIATEEAPDWTEVWRLGLDLSARTKD
LRVGILLTRSALSQFGFSGLSRGLELLAAYVELYWSELHPRPDPEDDEDQTVRLNALASLCDLSGLLAEI
RQVPLTSSRQFGTFTLRDWAGALRSQSTEIDRSTIEHAFIDTDPLQLEQISTGLHASLAAATHLDASVRQ
HVASDEAVRFDPLIVLLTQAKDLVDAHRKRAQPAAPASPLPDSSKASYPEVIRNRDDVVEILGRICHWYQ
VNEPASPLPALLERAQRLVSKDFMALIKELAPEGVAQYRSIAGLAVGEGT
 
Nucleotide Sequence: 993 bp     [Download]
>gi|190893983|ref|NC_010996.1|:c231435-230443 Rhizobium etli CIAT 652 plasmid pB, complete sequence
ATGCTCGATGCAGATCATCTATTAAAACCGATCAGCGACGGCAACGCATGCGGGGATGCTCTCGATTACG
ATTTGAGCTTCCTGGAGCTGGAGATAGCGTCGCATGGCAAGCCGCACCAGCAGATAGGCGACTCCATCGC
CACCGAGGAGGCTCCCGATTGGACAGAGGTGTGGCGGCTTGGCCTCGACCTTTCTGCCCGCACTAAGGAT
CTAAGAGTCGGCATCTTGCTCACACGATCCGCCCTCAGTCAGTTCGGCTTCTCTGGTCTAAGTCGGGGGC
TTGAGCTGCTCGCGGCCTATGTCGAGCTCTACTGGTCAGAGCTACATCCGCGACCGGATCCAGAAGATGA
CGAAGATCAGACCGTTCGCCTCAACGCTCTAGCGAGCCTCTGCGATCTCTCCGGGCTCTTGGCAGAAATA
CGCCAAGTCCCACTCACCTCCTCCAGGCAATTCGGGACTTTTACGCTCCGCGATTGGGCTGGTGCGCTAC
GGTCCCAATCTACGGAAATTGATCGTTCGACCATCGAGCACGCCTTCATCGACACCGACCCACTGCAGCT
CGAGCAGATCAGCACTGGTCTCCACGCCAGCCTGGCAGCCGCCACCCATCTAGACGCGAGTGTTCGGCAG
CACGTCGCGAGTGACGAGGCCGTTCGATTCGACCCTCTGATAGTGCTACTCACCCAGGCCAAGGATCTGG
TCGACGCCCATCGGAAAAGGGCCCAGCCTGCAGCCCCGGCATCTCCATTGCCAGACTCTAGCAAGGCCTC
TTACCCCGAAGTGATCCGCAACCGCGATGACGTTGTCGAAATTCTTGGCCGCATTTGCCACTGGTACCAG
GTGAATGAGCCCGCGAGCCCACTGCCAGCCCTCCTGGAGCGCGCGCAGCGACTTGTCTCGAAGGACTTCA
TGGCTCTTATCAAAGAGTTGGCGCCAGAAGGGGTTGCCCAATACCGTTCGATTGCCGGTCTGGCGGTCGG
CGAGGGCACGTGA