SecReT6
Protein ID: 190894190
SecReT6 ID290
T6SS typei3
Gene symbol-
Locus tagRHECIAT_PB0000224
StrainRhizobium etli CIAT 652
Repliconplasmid pB [GenBank: NC_010996] [Browse all T6SS(s) in this replicon]
Location [Strand]238008..239363 [+]
Producthypothetical protein
NoteTssK
UniProt IDB3Q2M8
KEGG IDrec:RHECIAT_PB0000224
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.10E-147, Aligned region: 19..443
Protein Sequence: 451 a.a.     [Download]
>gi|190894190|ref|YP_001984484.1| hypothetical protein RHECIAT_PB0000224 [Rhizobium etli CIAT 652]
MSWNNRVVWSEGLFLRPQHFQQADRHVEQLVRSRTAVLHGYGWGISELRLNRELLGLGKIAIEAARGVLE
DGMPFSIPDEANQPTPYDVPPDFRDSLIHLAVPFYQPGALETDAQAGIDVPIRFAVSTEDVVDTNAGERG
SASIDVARLDFRLLPDAADRSGYTCIPIARIIEVRADRQIILDETHVPPTPDCASSRVLSNYITEITGLL
HHRGEALATRVSQSGTNRVAELADFLLLQAINRYEPYFCHLSKAAVVNPESLYVLMLQLAGELATFARVD
KRAPTLGVYKHDSLAEAFLPVMQSIRASLGAVIEQTAVPVPLQRQKYGVHVAEVADRSLFTTSSFVLAAR
ADIEVERLRREFPSQIKIGPAEKITELVNVALPGIIINPLPVAPRQIPFHVGFSYFEIDQNSRFWKDMPQ
SAGLALHVAGDFPNLEMALWAIRAGQNPHLS
 
Nucleotide Sequence: 1356 bp     [Download]
>gi|190893983|ref|NC_010996.1|:238008-239363 Rhizobium etli CIAT 652 plasmid pB, complete sequence
ATGTCGTGGAATAATAGGGTCGTCTGGTCGGAGGGCTTGTTCCTCCGCCCGCAGCATTTTCAGCAGGCCG
ATCGTCACGTCGAACAGCTGGTGCGCAGCAGGACGGCGGTTTTGCATGGGTACGGGTGGGGTATCAGCGA
GCTGCGGCTCAATCGAGAGCTGCTTGGTCTCGGTAAGATCGCCATCGAAGCGGCTCGCGGCGTCTTGGAG
GACGGGATGCCCTTCAGTATTCCTGACGAAGCCAACCAGCCAACTCCCTACGACGTTCCGCCGGATTTTC
GAGATTCGCTTATTCACTTGGCGGTACCGTTTTATCAACCCGGCGCTCTTGAAACCGACGCGCAAGCGGG
AATTGACGTACCTATCCGCTTCGCAGTCTCCACTGAGGATGTTGTCGACACCAACGCTGGCGAGCGAGGC
AGCGCCTCCATCGACGTAGCGAGGCTGGATTTTCGACTGCTGCCGGACGCGGCAGACCGGTCTGGCTACA
CTTGCATCCCAATCGCCCGTATCATAGAGGTCCGGGCCGACCGACAGATCATTCTGGACGAAACGCACGT
GCCGCCAACCCCCGACTGCGCCAGCTCCCGGGTCCTCTCGAACTACATCACTGAGATCACCGGCCTGCTT
CACCATCGTGGTGAAGCTCTGGCCACTCGGGTCTCCCAGTCGGGAACGAACCGGGTTGCAGAGCTCGCGG
ACTTCCTTCTGCTGCAGGCGATCAATCGGTACGAGCCGTACTTCTGCCACCTATCCAAGGCCGCCGTTGT
AAATCCGGAATCGCTGTATGTTCTCATGCTCCAGTTGGCGGGTGAACTAGCCACGTTCGCCCGCGTCGAT
AAACGTGCCCCGACCCTTGGTGTTTACAAGCACGACTCTCTCGCGGAGGCGTTTTTGCCAGTGATGCAGT
CGATCCGGGCTTCGCTGGGTGCAGTGATTGAGCAGACTGCGGTCCCCGTACCGCTGCAGCGGCAAAAATA
CGGTGTCCATGTGGCCGAGGTGGCCGACCGCTCTCTCTTTACGACCTCGAGCTTCGTGCTGGCTGCTCGG
GCTGATATTGAGGTCGAGCGCCTCCGGCGCGAGTTCCCGTCTCAGATTAAGATCGGCCCGGCGGAGAAAA
TCACGGAACTCGTCAATGTCGCACTGCCCGGCATTATCATCAATCCCCTACCGGTCGCGCCGCGTCAGAT
CCCGTTCCATGTTGGATTCAGCTATTTCGAGATCGATCAAAATAGCCGCTTCTGGAAGGATATGCCCCAA
TCCGCCGGCTTGGCGCTGCACGTTGCTGGCGACTTCCCAAATCTCGAAATGGCTCTCTGGGCCATCCGAG
CCGGACAGAACCCACATTTGAGTTAG