SecReT6
Protein ID: 190894191
SecReT6 ID290
T6SS typei3
Gene symbol-
Locus tagRHECIAT_PB0000225
StrainRhizobium etli CIAT 652
Repliconplasmid pB [GenBank: NC_010996] [Browse all T6SS(s) in this replicon]
Location [Strand]239371..240591 [+]
Producthypothetical protein
NoteFha
UniProt IDB3Q2M9
KEGG IDrec:RHECIAT_PB0000225
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 0.00013, Aligned region: 33..95
Protein Sequence: 406 a.a.     [Download]
>gi|190894191|ref|YP_001984485.1| hypothetical protein RHECIAT_PB0000225 [Rhizobium etli CIAT 652]
MPLTLRVHSNRCSFPEYLVPGDAAGGLTTSRAGNSLVLPDDQQMVSKSHCSIECMARRYVLIDRGRDDTC
QNDEAMPLPSEAPVARKTSDVIQIGAYMTDVVAVSPSISIAESAAEPEGQLAATSEELSLLGPLETASSL
LAGNCTRGEEALLDLRDGEFLPLPFLGTRLDALAGMMRSPWDIYADSVPDRAPILTQPKVEQSSRQESSS
GGHGFPCRLRLIIGRCPECRHRKRAGSCRENASVFRRAAQHTLRARAGEQLFRNKSSDEKTLSLVPDVGE
ALRAVLCNDSSGSLRGDPAVEQAFTDRGTHDVSFAAVQKALSSVRARLSLAGIEKAMGRPRSLLHRNHKA
RNRSAYVRVFNDVVSSIETDLLRSFGADFARPVRERSRPARRSHDESVRSEGKWAG
 
Nucleotide Sequence: 1221 bp     [Download]
>gi|190893983|ref|NC_010996.1|:239371-240591 Rhizobium etli CIAT 652 plasmid pB, complete sequence
ATGCCCCTCACGCTACGTGTACACAGCAATAGATGTAGTTTTCCGGAATATCTCGTGCCGGGCGACGCGG
CTGGTGGACTGACTACCAGCCGAGCAGGCAACAGCCTGGTTCTGCCGGATGATCAGCAGATGGTCTCGAA
ATCCCACTGCTCAATCGAGTGCATGGCACGGCGATACGTACTGATCGACCGAGGCCGCGACGACACATGT
CAAAATGACGAGGCGATGCCGCTTCCGTCAGAGGCGCCGGTCGCCCGGAAAACCAGCGATGTTATTCAGA
TCGGCGCCTATATGACCGATGTCGTCGCGGTGTCGCCTTCGATATCCATTGCGGAGAGTGCCGCCGAACC
GGAGGGACAACTTGCAGCGACAAGTGAGGAGTTGAGTCTTCTTGGCCCCCTCGAAACGGCCTCGTCGCTC
CTGGCGGGCAATTGCACCCGGGGTGAAGAAGCGCTGCTGGACCTGAGGGACGGCGAGTTCCTACCATTGC
CGTTCTTAGGCACTCGTTTAGACGCGCTGGCGGGCATGATGAGAAGTCCGTGGGATATCTACGCAGACAG
TGTGCCAGATCGGGCCCCCATCTTGACGCAACCCAAGGTGGAGCAATCATCTCGCCAAGAATCATCGAGC
GGCGGTCACGGCTTTCCTTGCCGCCTGCGGCTTATCATTGGCAGATGTCCGGAATGCCGGCATCGTAAGC
GTGCTGGATCGTGCAGGGAAAATGCTTCTGTATTCCGCCGCGCTGCACAGCATACTCTCCGAGCGAGAGC
TGGCGAACAATTATTCAGAAATAAGAGTTCCGACGAAAAAACCCTGAGTCTCGTTCCCGATGTCGGTGAG
GCGTTGCGCGCAGTTCTGTGCAATGACTCCAGCGGGTCCCTCCGCGGAGACCCGGCCGTTGAGCAAGCCT
TCACCGACCGTGGGACGCATGACGTGTCATTCGCGGCTGTGCAGAAGGCTCTGTCCAGCGTCCGTGCACG
CTTGTCCCTAGCAGGGATCGAGAAGGCGATGGGGCGGCCCCGTTCCCTTTTGCACCGCAACCATAAGGCG
CGAAACCGGAGTGCGTACGTGCGCGTCTTCAATGACGTCGTATCGAGCATCGAAACCGATTTGCTCCGGA
GCTTCGGCGCCGACTTCGCGCGCCCAGTGCGAGAGCGTAGTCGACCCGCCCGCCGATCCCACGATGAGAG
CGTCCGCTCCGAAGGGAAGTGGGCGGGTTGA