SecReT6
Protein ID: 190894192
SecReT6 ID290
T6SS typei3
Gene symbol-
Locus tagRHECIAT_PB0000226
StrainRhizobium etli CIAT 652
Repliconplasmid pB [GenBank: NC_010996] [Browse all T6SS(s) in this replicon]
Location [Strand]240591..241880 [+]
Producthypothetical protein
NoteTssL
UniProt IDB3Q2N0
KEGG IDrec:RHECIAT_PB0000226
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 7.00E-63, Aligned region: 47..251
OmpA [PF00691], Evalue: 1.40E-09, Aligned region: 322..419
Protein Sequence: 429 a.a.     [Download]
>gi|190894192|ref|YP_001984486.1| hypothetical protein RHECIAT_PB0000226 [Rhizobium etli CIAT 652]
MMVIEETMPKSQPLVLLHAEEQLAVPSPSSPVADELTWEMLALDRLNPLVAAAAALLGLSAQLKSSASHI
DVEALRLRVLREIDAFERRITPLGLPSRAIKVCKYALCATIDDIVLNTAWGSNSVWTTRSLVGSLFSDTW
GGERFFDLLTQLKNEPAINIELLELLYYCMRLGFEGRYRVTAGGAAELSVLCEDVYRLIRAARGDFEREL
SPHWRRNSNNPKPRRTIVPIWAVVAFGAGLLLSIYTGLLHALNARADAVFNDIATLPPNGVVRSARIALP
PKVVMSSDRLRNFLEPEIREGLVTVSEDPQQIVVIIRASGMFDSASPEVKKMFLPLLLRIGRSLNGESGS
VLLTGHTDAIPVQSLAFPSNDSLSLARASAAAEIIKSMMDDPGRVREEGRGSGEPVASNHTPEGRARNRR
IQIIITKTQ
 
Nucleotide Sequence: 1290 bp     [Download]
>gi|190893983|ref|NC_010996.1|:240591-241880 Rhizobium etli CIAT 652 plasmid pB, complete sequence
ATGATGGTGATTGAGGAAACGATGCCAAAATCCCAGCCACTCGTCCTCCTTCACGCCGAGGAGCAGTTGG
CTGTCCCTTCGCCGTCATCGCCAGTGGCGGACGAACTTACCTGGGAGATGCTTGCGCTCGACCGACTTAA
TCCACTGGTCGCGGCCGCGGCGGCGCTGCTGGGTCTCAGCGCTCAGCTCAAGAGCAGTGCTAGCCATATC
GACGTTGAAGCACTGCGCCTTAGGGTGCTGCGGGAGATCGATGCTTTTGAGCGTCGGATCACGCCGCTCG
GATTGCCCTCGCGAGCGATCAAGGTCTGCAAATACGCCCTCTGCGCGACCATCGATGACATCGTTCTGAA
CACAGCCTGGGGCAGCAACAGCGTCTGGACGACGCGCAGCTTGGTGGGATCGCTGTTCAGCGATACCTGG
GGCGGCGAGCGCTTCTTCGATCTGCTGACGCAATTGAAAAATGAACCGGCCATCAATATAGAACTGCTGG
AGCTGCTCTACTACTGCATGAGGTTGGGCTTCGAAGGCCGCTACCGCGTCACTGCGGGAGGAGCCGCAGA
GCTCAGTGTGCTGTGCGAAGACGTCTACCGCCTGATCCGAGCAGCCCGTGGTGACTTCGAGCGCGAACTA
TCCCCGCACTGGCGGAGGAACTCAAATAATCCGAAGCCACGCCGCACAATCGTTCCAATCTGGGCCGTCG
TAGCGTTTGGGGCAGGATTACTCCTCTCGATCTATACCGGACTCCTGCATGCATTAAATGCCCGCGCCGA
CGCTGTCTTCAACGATATCGCGACATTGCCGCCGAACGGCGTTGTCAGATCGGCGAGAATCGCATTGCCA
CCAAAGGTTGTTATGAGCAGCGACCGACTGCGTAACTTCCTCGAGCCCGAAATCCGCGAAGGGCTTGTCA
CTGTGTCCGAGGACCCACAGCAGATCGTCGTTATCATTCGCGCCTCCGGGATGTTCGATTCTGCTAGTCC
GGAAGTGAAGAAAATGTTCCTGCCGCTTCTTTTACGAATTGGTCGTTCTCTGAACGGTGAGTCGGGATCG
GTCCTCCTGACCGGGCACACCGACGCCATTCCGGTGCAATCACTCGCCTTCCCTTCAAACGATTCCCTTT
CGCTCGCGCGTGCGAGCGCAGCTGCCGAGATTATCAAATCCATGATGGATGACCCAGGCCGCGTGCGAGA
AGAGGGCAGAGGGAGCGGAGAACCGGTCGCTTCGAACCACACGCCCGAGGGCCGCGCGCGGAACCGTCGG
ATTCAAATCATCATCACAAAGACACAATGA