SecReT6
Protein ID: 190895263
SecReT6 ID291
T6SS typei3
Gene symbol-
Locus tagRHECIAT_PC0000936
StrainRhizobium etli CIAT 652
Repliconplasmid pC [GenBank: NC_010997] [Browse all T6SS(s) in this replicon]
Location [Strand]1026979..1027719 [+]
Producthypothetical protein
NoteTagL
UniProt IDB3Q499
KEGG IDrec:RHECIAT_PC0000936
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 3.70E-18, Aligned region: 145..238
Protein Sequence: 246 a.a.     [Download]
>gi|190895263|ref|YP_001985556.1| hypothetical protein RHECIAT_PC0000936 [Rhizobium etli CIAT 652]
MKRLLTVKLLVSLALVFTLQSGLRAQELDETALKERFQRQMELFKAAKLGPSRGLVLTNSGPAPEATPLP
IATPETTPTKVGSTQASSNPEASANPAKQETVGASPTPGNGPAETAPTTAAATITTPQTYWKLPDDDQVN
YRVQFAFDSSAIAPKQKPMLQKLCSVVKEMDIKLIRIVGHTDASGGARYNQNLSMLRAREVARFFTEDCH
IPPERLEAVGVGEQFPLDPQKPKADENRRVEFQAVS
 
Nucleotide Sequence: 741 bp     [Download]
>gi|190894340|ref|NC_010997.1|:1026979-1027719 Rhizobium etli CIAT 652 plasmid pC, complete sequence
ATGAAGCGCCTGCTGACTGTGAAGCTGCTGGTGTCTCTCGCTTTAGTCTTCACGCTACAAAGTGGATTGC
GTGCACAGGAACTGGATGAGACGGCGCTCAAGGAACGTTTCCAGAGACAAATGGAATTGTTCAAGGCCGC
CAAGCTGGGGCCGTCACGCGGCCTCGTGCTGACCAATTCCGGGCCTGCGCCGGAGGCGACGCCACTGCCG
ATCGCCACGCCCGAGACCACGCCGACCAAGGTCGGTTCCACTCAAGCGAGCAGCAATCCGGAGGCTTCGG
CAAATCCGGCTAAACAGGAAACTGTCGGGGCCAGTCCGACCCCGGGAAACGGGCCGGCCGAGACAGCACC
AACAACTGCAGCAGCGACGATAACAACACCTCAGACATATTGGAAACTGCCCGACGATGATCAGGTTAAC
TACCGGGTGCAGTTTGCCTTCGATTCCTCCGCGATCGCACCCAAGCAAAAGCCGATGCTGCAGAAGCTCT
GCAGTGTGGTGAAGGAAATGGATATTAAGCTCATTCGCATTGTCGGCCACACCGACGCCTCCGGTGGAGC
CCGGTACAATCAGAATCTCTCCATGCTGCGGGCAAGGGAAGTGGCGCGCTTCTTCACGGAGGATTGCCAT
ATTCCTCCTGAACGCCTCGAGGCTGTCGGTGTTGGCGAGCAATTTCCGCTCGATCCACAAAAGCCGAAAG
CTGACGAGAACCGACGTGTCGAATTCCAGGCCGTCAGCTAA