SecReT6
Protein ID: 190895266
SecReT6 ID291
T6SS typei3
Gene symbol-
Locus tagRHECIAT_PC0000939
StrainRhizobium etli CIAT 652
Repliconplasmid pC [GenBank: NC_010997] [Browse all T6SS(s) in this replicon]
Location [Strand]1032816..1033979 [+]
Producthypothetical protein
NoteTssA
UniProt IDB3Q4A2
KEGG IDrec:RHECIAT_PC0000939
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 7.60E-18, Aligned region: 57..116
Protein Sequence: 387 a.a.     [Download]
>gi|190895266|ref|YP_001985559.1| hypothetical protein RHECIAT_PC0000939 [Rhizobium etli CIAT 652]
MFDSALWLNPINGDNPSGESLRNDGRFHELERLVQPQIEISRDERNNPVARTEVPVDWSTVLRKSEELRA
QGRDLRLLVIVTRALANERGLAGLADGLNLIRQTFDMHWQTMHPELRDGLPPREAALRRINALIQLQNDK
DGLLADLRKMTFFAPRGAGPVTGRDLERGAIDGRTVLNEAAPGLSAAEKASLVSEHEQLLNRVRFGCAAF
AEQAADEAAALAADARTAVAALEAAERSLNLQIGGDLRVTLPDLSRFLQRVAATLERAKINAQQESPKED
TSGGEAAPVTTNGGADQGPIQPATVFPSRLSSRDEVTRCIDLIIAFYDRTEPSSPIPHLARRIKRMVPMD
FLELMEDLAPSGLKEFRLLAGVSESKKPAPGTKGDHP
 
Nucleotide Sequence: 1164 bp     [Download]
>gi|190894340|ref|NC_010997.1|:1032816-1033979 Rhizobium etli CIAT 652 plasmid pC, complete sequence
TTGTTCGACTCTGCGCTCTGGTTGAATCCGATAAACGGTGACAACCCGTCCGGCGAAAGCCTACGGAACG
ACGGACGATTCCACGAGCTCGAACGCCTCGTACAGCCGCAGATCGAAATCAGCCGAGACGAGCGCAACAA
CCCGGTCGCACGAACGGAAGTGCCGGTCGACTGGTCGACGGTGCTTCGCAAGTCGGAGGAGCTGCGGGCG
CAGGGCCGCGATCTCAGGCTGCTGGTGATCGTAACGCGCGCCCTTGCAAATGAACGGGGCTTGGCCGGCC
TTGCCGACGGATTGAACCTGATCCGCCAAACCTTCGACATGCACTGGCAGACAATGCATCCGGAGCTTCG
CGACGGCCTGCCTCCCCGCGAGGCCGCTCTTCGCCGCATCAATGCACTGATTCAGCTTCAAAATGACAAA
GATGGCCTGCTCGCCGATCTGCGCAAGATGACGTTCTTTGCGCCTCGTGGCGCTGGCCCGGTGACGGGAC
GCGATCTGGAGCGGGGGGCGATTGACGGCCGCACCGTCCTGAACGAAGCGGCGCCGGGTTTGAGTGCGGC
TGAGAAGGCTTCGCTCGTCAGCGAACATGAGCAATTGCTCAATCGCGTGCGGTTCGGGTGCGCCGCATTT
GCCGAACAGGCCGCTGATGAAGCCGCGGCGCTGGCCGCCGATGCAAGGACTGCCGTCGCAGCACTGGAGG
CGGCCGAACGGTCGCTCAATCTGCAGATCGGCGGCGATTTGCGCGTTACCCTGCCAGATCTGAGCCGGTT
TCTGCAGCGCGTGGCCGCGACCCTGGAGCGCGCCAAGATTAATGCGCAACAGGAGAGTCCGAAGGAAGAC
ACTTCAGGCGGCGAAGCAGCGCCGGTCACCACCAACGGCGGAGCAGACCAGGGGCCGATCCAGCCGGCGA
CAGTCTTCCCCTCCCGCCTGAGCTCGCGAGACGAAGTCACGCGCTGCATCGACCTCATCATCGCCTTTTA
CGACCGCACGGAGCCGTCAAGCCCCATTCCCCATCTGGCCCGCAGGATCAAGCGTATGGTGCCGATGGAT
TTTCTCGAGCTCATGGAGGACCTCGCTCCTTCCGGGCTGAAAGAATTCCGGCTTCTGGCCGGCGTTTCGG
AAAGCAAGAAACCTGCCCCTGGGACAAAAGGTGACCATCCATGA