SecReT6
Protein ID: 190895267
SecReT6 ID291
T6SS typei3
Gene symbol-
Locus tagRHECIAT_PC0000940
StrainRhizobium etli CIAT 652
Repliconplasmid pC [GenBank: NC_010997] [Browse all T6SS(s) in this replicon]
Location [Strand]1033976..1034512 [+]
Producthypothetical protein
NoteTssB
UniProt IDB3Q4A3
KEGG IDrec:RHECIAT_PC0000940
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.80E-53, Aligned region: 9..169
Protein Sequence: 178 a.a.     [Download]
>gi|190895267|ref|YP_001985560.1| hypothetical protein RHECIAT_PC0000940 [Rhizobium etli CIAT 652]
MSETKAKVIERNRAPRVQIAYEVETYGSPTTIELPFVMGVMADLAGASQTPEALKSVRDRTFVETDANRF
GRFMEALSPRVKARVKNTLPQPPGEERDEELAVDLTFTSMGDFAPDRIAEQVPQLAELLRMRRQLEELLG
FMDGRVDAEKRIAQLLNNEPLLAKIADQAIDDGSKSEG
 
Nucleotide Sequence: 537 bp     [Download]
>gi|190894340|ref|NC_010997.1|:1033976-1034512 Rhizobium etli CIAT 652 plasmid pC, complete sequence
ATGAGCGAAACTAAGGCGAAGGTGATCGAACGCAACAGGGCGCCTCGCGTCCAGATCGCCTATGAAGTGG
AAACATATGGCAGCCCGACCACGATCGAATTGCCTTTCGTGATGGGGGTGATGGCAGATCTCGCCGGCGC
GTCCCAAACGCCGGAGGCACTGAAATCCGTTCGGGACCGGACCTTTGTCGAGACCGACGCCAACCGCTTC
GGCCGCTTCATGGAAGCACTGAGCCCGCGCGTGAAGGCGCGGGTCAAGAACACGCTTCCCCAACCGCCCG
GCGAAGAGCGGGACGAGGAACTTGCCGTCGACCTGACCTTTACGAGCATGGGCGATTTCGCTCCGGACCG
GATTGCCGAACAGGTTCCCCAGCTCGCCGAACTCCTGAGGATGCGCCGCCAACTCGAGGAATTGCTGGGC
TTCATGGATGGCCGTGTCGACGCCGAAAAGCGTATCGCCCAGCTTTTGAACAACGAGCCCCTTTTGGCAA
AAATCGCCGACCAGGCGATCGATGATGGCAGCAAGTCGGAGGGCTGA