SecReT6
Protein ID: 190895268
SecReT6 ID291
T6SS typei3
Gene symbol-
Locus tagRHECIAT_PC0000941
StrainRhizobium etli CIAT 652
Repliconplasmid pC [GenBank: NC_010997] [Browse all T6SS(s) in this replicon]
Location [Strand]1034516..1036024 [+]
Producthypothetical protein
NoteTssC
UniProt IDB3Q4A4
KEGG IDrec:RHECIAT_PC0000941
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.40E-178, Aligned region: 69..498
Protein Sequence: 502 a.a.     [Download]
>gi|190895268|ref|YP_001985561.1| hypothetical protein RHECIAT_PC0000941 [Rhizobium etli CIAT 652]
MAEQEKTAAVDVKEAEGVDLQEFSDLLEKDFKVKKDDSEKLQTLVQNLALAARARSQSTTISSNAIKSIK
SLISGIDKLLTEQVNEVLHAPEVLQLEGTWRGLWYLVNNTETDQKLKIRVMNISKEALADTLEDYEGQMW
DQSPIFKKVYTDEYSMLGGSPYGCLIGAYEFSNHPKDVALLRNMSGICASAHTPFIAAAAPRLFRMESWQ
ELPNPQDLQQIVSSPAYASWQSLRESEDARYIGLTMPRVLARLPYGAETIPVKGFAFEEDVQGDHHRYVW
MNAAFPMGVNINRSHKLFGWGTQIRGVENGGAVVNLPVHNFPTDDGTVAMKCPTEVAIDDRREAELAKLG
LMPILHRKNTDIAAFIGAHSLQDDETRAGRLVDPDAQANERLSANLPYLFPVSRFAHYLKAIARDKIGSF
KERSDMQIWLTEWINRYVLANPAFADDKARAKRPLAAAEVQVDSVEGRPGWYNARFYLRPHYQLEGINAS
LRLVSELPSTKS
 
Nucleotide Sequence: 1509 bp     [Download]
>gi|190894340|ref|NC_010997.1|:1034516-1036024 Rhizobium etli CIAT 652 plasmid pC, complete sequence
ATGGCCGAACAGGAAAAAACAGCCGCTGTCGACGTCAAGGAAGCCGAAGGCGTCGATCTTCAGGAATTCA
GTGATCTTCTTGAAAAGGACTTCAAGGTCAAGAAGGACGACAGCGAGAAGCTGCAGACCCTTGTGCAAAA
TCTGGCGCTTGCAGCGCGCGCGCGTTCGCAGTCGACGACAATCTCCTCGAATGCGATCAAGTCGATCAAA
TCCCTGATCTCCGGCATCGACAAGCTTCTGACCGAGCAGGTCAACGAAGTTCTCCATGCGCCCGAAGTGC
TGCAACTCGAGGGAACATGGCGCGGTCTGTGGTATCTCGTCAACAATACCGAGACGGATCAGAAGCTGAA
GATCCGCGTCATGAATATCTCGAAAGAAGCTCTGGCCGACACGCTCGAAGATTACGAAGGTCAGATGTGG
GATCAGAGTCCCATATTCAAGAAAGTCTATACGGACGAATACTCGATGCTTGGCGGCAGCCCGTACGGAT
GCCTGATCGGTGCCTACGAATTCTCCAACCACCCGAAGGACGTCGCTCTCCTTCGCAACATGTCCGGCAT
CTGCGCGTCGGCGCACACACCCTTCATTGCCGCCGCTGCCCCGCGACTCTTCCGCATGGAAAGCTGGCAG
GAACTGCCAAACCCCCAGGACCTGCAACAGATTGTCTCGTCGCCCGCCTACGCGTCCTGGCAGTCCCTGC
GAGAGAGCGAGGATGCGCGTTACATCGGCCTGACGATGCCCCGGGTCCTTGCGCGCCTGCCCTATGGCGC
GGAAACCATTCCGGTAAAGGGCTTCGCCTTCGAGGAGGATGTCCAGGGCGATCATCATCGCTACGTGTGG
ATGAATGCCGCCTTCCCGATGGGCGTCAATATCAATCGAAGCCACAAGCTGTTTGGCTGGGGCACGCAAA
TTCGCGGCGTCGAGAACGGTGGAGCGGTCGTCAATCTTCCAGTCCACAATTTCCCGACTGACGATGGTAC
TGTCGCGATGAAATGCCCGACGGAGGTCGCCATCGACGATCGCCGCGAGGCAGAGCTTGCCAAGCTTGGG
CTGATGCCGATCCTGCATCGCAAGAACACGGACATCGCAGCCTTCATCGGTGCGCACTCGTTACAGGATG
ACGAGACGCGCGCCGGGCGCCTGGTCGATCCGGATGCGCAGGCCAATGAGCGCCTGAGCGCAAATCTGCC
GTATCTTTTCCCGGTTTCGCGTTTCGCGCATTACCTGAAGGCAATCGCCCGCGACAAGATCGGTTCGTTC
AAGGAGCGGTCCGATATGCAGATCTGGCTGACGGAGTGGATCAATCGCTACGTTCTTGCCAACCCTGCCT
TTGCCGACGACAAGGCTCGCGCCAAACGGCCGCTGGCTGCCGCCGAGGTTCAGGTCGACAGCGTCGAAGG
CCGACCGGGATGGTACAATGCCCGGTTCTATCTGCGCCCCCATTATCAGTTGGAAGGCATCAATGCGTCA
CTGCGTCTCGTATCGGAGCTGCCGTCGACGAAGAGCTGA