SecReT6
Protein ID: 190895269
SecReT6 ID291
T6SS typei3
Gene symbol-
Locus tagRHECIAT_PC0000942
StrainRhizobium etli CIAT 652
Repliconplasmid pC [GenBank: NC_010997] [Browse all T6SS(s) in this replicon]
Location [Strand]1036045..1036494 [+]
Producthypothetical protein
NoteTssD
UniProt IDB3Q4A5
KEGG IDrec:RHECIAT_PC0000942
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.00E-30, Aligned region: 6..135
Protein Sequence: 149 a.a.     [Download]
>gi|190895269|ref|YP_001985562.1| hypothetical protein RHECIAT_PC0000942 [Rhizobium etli CIAT 652]
MKIDGFLKVPDITGPSVRDGHEDEIEIHGVEFEMVAPYDPNSLSRRGRVSLGMINFIKHYDKSSPYLKKA
LFDNTLLGEVKFSARRTIEGETSDYLVVTLKDASVTQYNMKQSEDEPDLIEERVGFAYKNITFNYDDKDE
VEMDVYVGK
 
Nucleotide Sequence: 450 bp     [Download]
>gi|190894340|ref|NC_010997.1|:1036045-1036494 Rhizobium etli CIAT 652 plasmid pC, complete sequence
ATGAAAATTGACGGTTTTCTCAAGGTACCGGATATTACGGGACCGAGCGTTCGCGATGGCCACGAAGACG
AGATCGAAATCCACGGCGTGGAGTTTGAGATGGTCGCCCCCTACGATCCCAACTCGCTCTCGCGACGGGG
CCGCGTCAGTCTGGGCATGATCAATTTCATCAAGCACTATGACAAATCCTCGCCCTATCTGAAAAAGGCG
CTGTTCGACAACACGCTTCTCGGCGAGGTGAAGTTCTCCGCGCGCAGAACGATCGAAGGCGAGACCAGTG
ATTATCTGGTCGTTACGCTGAAGGACGCTTCGGTCACCCAGTACAATATGAAGCAAAGCGAGGACGAACC
CGATCTCATCGAGGAGCGCGTCGGCTTCGCCTACAAGAACATCACCTTCAACTACGACGACAAGGACGAG
GTCGAAATGGATGTCTATGTCGGCAAGTGA