SecReT6
Protein ID: 190895270
SecReT6 ID291
T6SS typei3
Gene symbol-
Locus tagRHECIAT_PC0000943
StrainRhizobium etli CIAT 652
Repliconplasmid pC [GenBank: NC_010997] [Browse all T6SS(s) in this replicon]
Location [Strand]1036481..1037242 [+]
Producthypothetical protein
NoteTssE
UniProt IDB3Q4A6
KEGG IDrec:RHECIAT_PC0000943
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.30E-22, Aligned region: 48..63
GPW_gp25 [PF04965], Evalue: 2.30E-22, Aligned region: 110..233
Protein Sequence: 253 a.a.     [Download]
>gi|190895270|ref|YP_001985563.1| hypothetical protein RHECIAT_PC0000943 [Rhizobium etli CIAT 652]
MSASDGWRKEVGRESRPLGGHQRATRETIQPSLWDRLVNDLPGLGSEIKDLRQILQSEIDAERLDAMVAG
GVGHIESATDLSIEQKKNIHRLFSLERRRLELDSRGVVVSSDVLREAVRRDIEALFNVQRFESSLLLTDA
EAELVGENPPSLEDFPQVRRSVVNYGVPPFSGRSSRDFDREELAKEITQVLAAFEPRLKEGATKVTVSLG
DKSIGLRIDIDALLLTTPAPERLRIRTILDLDNGSARTELKDT
 
Nucleotide Sequence: 762 bp     [Download]
>gi|190894340|ref|NC_010997.1|:1036481-1037242 Rhizobium etli CIAT 652 plasmid pC, complete sequence
ATGTCGGCAAGTGACGGCTGGCGAAAAGAAGTTGGAAGGGAGTCGAGACCGCTTGGCGGGCACCAGCGCG
CAACCCGCGAAACGATCCAGCCATCCTTGTGGGATCGCCTGGTCAATGACCTGCCGGGGCTCGGCTCCGA
GATCAAAGATCTCCGGCAGATATTGCAAAGCGAGATAGACGCCGAGCGGCTGGACGCGATGGTGGCCGGT
GGCGTCGGGCACATCGAGTCAGCAACGGATCTCAGCATCGAGCAGAAAAAGAACATCCATCGTCTCTTTT
CCCTGGAACGTCGTCGCCTGGAACTGGACAGTCGCGGCGTGGTCGTTTCGAGCGATGTGCTTCGTGAGGC
GGTGCGCCGCGACATCGAGGCGCTTTTCAATGTGCAGCGTTTCGAATCCTCGCTCCTTTTGACCGATGCG
GAGGCCGAACTGGTGGGCGAGAACCCTCCCTCGCTCGAAGATTTTCCGCAGGTGCGCCGCAGTGTGGTCA
ACTACGGCGTGCCGCCGTTTTCGGGCCGCTCATCGCGTGACTTCGACCGTGAGGAACTCGCCAAGGAAAT
CACACAAGTGCTTGCGGCATTCGAGCCCCGGCTCAAAGAAGGCGCAACCAAGGTGACCGTCAGTCTTGGC
GACAAGTCAATCGGCCTCAGGATCGATATTGACGCGCTTCTCCTGACGACACCGGCGCCAGAACGGCTTC
GCATCCGCACCATTCTCGATCTCGACAACGGCTCGGCGAGAACCGAGTTGAAGGACACCTGA