SecReT6
Protein ID: 190895272
SecReT6 ID291
T6SS typei3
Gene symbol-
Locus tagRHECIAT_PC0000945
StrainRhizobium etli CIAT 652
Repliconplasmid pC [GenBank: NC_010997] [Browse all T6SS(s) in this replicon]
Location [Strand]1039265..1040152 [+]
Producthypothetical protein
NoteTssG
UniProt IDB3Q4A8
KEGG IDrec:RHECIAT_PC0000945
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 6.30E-74, Aligned region: 2..265
Protein Sequence: 295 a.a.     [Download]
>gi|190895272|ref|YP_001985565.1| hypothetical protein RHECIAT_PC0000945 [Rhizobium etli CIAT 652]
MQDIARLEPSTETAPARVTVATIGLLGPEGPMPLYLTRWVLDRLSQRWFAGADMREVSDTTFVDFVNVLQ
HRMIALFYRAWADAHPAVQIERAEGGRIRAMAAAMAGIGLRGTVERQPTAIDLTKLAHAAALAHQVDGPE
RLTQFLGDHFKVPFRLREFVGVWMDIPQRIQSRLARAHAQLGRSATIGPRTFQRQQRIELSVGPLTLRDY
AAFLPGSERRANLQTAIRDLMGNGLDVDVRLVLKRDEVPAAQLGKARLGHIAWLAPKQDRGDAADLCMRT
LVGFRHEIAEATAWP
 
Nucleotide Sequence: 888 bp     [Download]
>gi|190894340|ref|NC_010997.1|:1039265-1040152 Rhizobium etli CIAT 652 plasmid pC, complete sequence
GTGCAGGACATCGCAAGGCTCGAGCCTTCCACCGAGACAGCGCCCGCCCGGGTAACAGTGGCGACGATCG
GCTTGCTCGGTCCGGAAGGTCCGATGCCGCTTTATCTGACGCGCTGGGTTCTGGATCGCCTGTCGCAGCG
CTGGTTTGCCGGTGCCGACATGCGCGAGGTCAGCGACACCACGTTCGTCGACTTCGTCAATGTGCTTCAA
CATCGCATGATCGCACTCTTCTATCGGGCGTGGGCGGATGCGCACCCGGCCGTGCAGATCGAGCGCGCCG
AGGGCGGTCGCATTCGTGCCATGGCGGCGGCCATGGCAGGGATCGGCCTGCGAGGCACGGTTGAGCGCCA
ACCAACGGCGATCGACCTGACGAAGCTTGCTCACGCCGCGGCCCTTGCTCATCAGGTCGACGGGCCTGAA
AGGCTCACGCAGTTTCTTGGCGATCATTTCAAGGTTCCTTTCAGGCTTCGGGAATTTGTCGGTGTCTGGA
TGGACATACCGCAAAGGATCCAGTCCCGTCTTGCCCGCGCCCATGCACAGCTTGGCAGAAGCGCCACGAT
CGGGCCGAGAACATTCCAGCGACAGCAACGAATCGAACTTTCCGTCGGACCATTGACGCTTCGTGATTAC
GCAGCCTTTCTGCCCGGCAGCGAACGGCGTGCGAACTTGCAAACGGCGATCCGCGATCTGATGGGAAACG
GGCTCGATGTGGATGTCAGGCTCGTGCTCAAACGAGACGAGGTGCCCGCAGCCCAGCTGGGAAAAGCCCG
GCTCGGGCATATCGCCTGGCTCGCTCCGAAACAGGATCGAGGCGACGCTGCCGATTTGTGCATGCGCACC
CTCGTTGGCTTTCGTCATGAGATTGCGGAGGCCACCGCATGGCCTTGA