SecReT6
Protein ID: 190895273
SecReT6 ID291
T6SS typei3
Gene symbol-
Locus tagRHECIAT_PC0000946
StrainRhizobium etli CIAT 652
Repliconplasmid pC [GenBank: NC_010997] [Browse all T6SS(s) in this replicon]
Location [Strand]1040197..1041417 [+]
Producthypothetical protein
NoteFha
UniProt IDB3Q4A9
KEGG IDrec:RHECIAT_PC0000946
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 3.90E-12, Aligned region: 9..77
Protein Sequence: 406 a.a.     [Download]
>gi|190895273|ref|YP_001985566.1| hypothetical protein RHECIAT_PC0000946 [Rhizobium etli CIAT 652]
MRLVEGELVIGRSAEADWRIDDPDMYVSRAHCTIACVQGRYQVTDTSSGGLFIDGSRAPLGAGNSAPLHD
GARLQLGNYVVRVELQSMQAERSPEQTTSQPPIGFARDSFFSERSERVESPRRPAGLPDPFEHPAAAPFT
DPDRQEPKKSAPLFDDPFSLDPLPAQRQDNRAWDLFMTGTPIEQPAPEPATAPINPQSNPEPQLEPRQQK
TAPIETDLRDAFLRGLGFRGEEYPSADPIVQMENFGREYRMMLEGLIHLLRKRAEEKGEARIAQTVVGAS
EVNPLKFMPTVDDVIAMFLTQRNVGFLPPDAAINGSIRDLAHHHVRTWRGVQAALERMVTRFDPAALESE
LKSQSAWDALLAGGRRAKLWELYEKRYREIARSASTRFLGEIGSDFRDGYEEREKE
 
Nucleotide Sequence: 1221 bp     [Download]
>gi|190894340|ref|NC_010997.1|:1040197-1041417 Rhizobium etli CIAT 652 plasmid pC, complete sequence
ATGCGGCTCGTCGAGGGCGAGCTCGTTATCGGTCGCAGCGCAGAGGCCGACTGGCGGATCGACGATCCGG
ACATGTATGTTTCCCGTGCCCATTGCACGATTGCTTGCGTTCAGGGTCGATATCAGGTGACGGATACGTC
AAGCGGCGGCCTCTTCATAGACGGCTCGCGCGCACCACTTGGAGCGGGAAATTCCGCCCCGTTGCATGAC
GGCGCCCGGCTGCAGCTCGGCAATTATGTCGTCCGGGTCGAGCTGCAAAGCATGCAGGCAGAGCGTTCGC
CTGAACAAACGACATCGCAGCCGCCGATCGGCTTCGCACGAGATTCTTTCTTCTCGGAACGCAGCGAGCG
GGTTGAATCCCCCCGACGACCCGCCGGATTGCCTGACCCGTTCGAACACCCCGCTGCGGCGCCATTTACC
GATCCGGACCGACAGGAGCCGAAAAAGAGCGCGCCCCTCTTCGACGATCCGTTCAGCCTCGACCCGCTAC
CGGCCCAGCGGCAGGACAACCGGGCCTGGGATCTTTTTATGACGGGCACGCCTATAGAGCAGCCGGCGCC
GGAGCCCGCCACAGCACCAATCAACCCGCAATCCAATCCGGAACCACAGCTGGAGCCGAGGCAGCAGAAA
ACAGCTCCGATCGAGACCGACCTGCGCGACGCCTTTCTGCGCGGATTGGGCTTCCGTGGCGAGGAATATC
CGTCTGCCGATCCCATCGTCCAGATGGAGAATTTTGGCCGGGAATACCGGATGATGCTGGAAGGATTGAT
CCATCTTCTGCGCAAGCGGGCCGAAGAAAAGGGCGAGGCCCGGATCGCGCAGACCGTTGTCGGGGCCTCC
GAAGTCAACCCTCTCAAATTCATGCCGACCGTCGACGATGTGATCGCGATGTTCCTCACGCAACGCAATG
TCGGATTCTTACCGCCCGATGCAGCGATCAACGGCTCCATCCGCGATCTCGCGCACCATCACGTGCGCAC
GTGGCGTGGTGTCCAGGCCGCGCTGGAAAGGATGGTCACCCGCTTCGATCCGGCGGCGCTGGAAAGCGAA
TTAAAGTCTCAATCGGCCTGGGACGCGCTGCTTGCCGGCGGGCGACGGGCAAAACTCTGGGAACTTTACG
AGAAACGCTATCGCGAAATTGCCAGGAGTGCATCAACGCGCTTCCTCGGCGAAATCGGCAGCGATTTCCG
GGACGGCTACGAAGAGAGGGAGAAAGAATGA