SecReT6
Protein ID: 190895274
SecReT6 ID291
T6SS typei3
Gene symbol-
Locus tagRHECIAT_PC0000947
StrainRhizobium etli CIAT 652
Repliconplasmid pC [GenBank: NC_010997] [Browse all T6SS(s) in this replicon]
Location [Strand]1041417..1041878 [+]
Producthypothetical protein
NoteTssJ
UniProt IDB3Q4B0
KEGG IDrec:RHECIAT_PC0000947
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.70E-29, Aligned region: 16..145
Protein Sequence: 153 a.a.     [Download]
>gi|190895274|ref|YP_001985567.1| hypothetical protein RHECIAT_PC0000947 [Rhizobium etli CIAT 652]
MLQRRGFLMMLGMTGLISGCVGGPPKSSTVTVKATGQAGMNLAADGGDRPVTVLVLRLKDVGKFNSADIF
ALQSDPASALGADLIGSDQLTVSPGGSATKTVAFPPEATFLGVVAFFRTPGGRVWRQAVPIKPESTVTAN
VALSSGGMALALA
 
Nucleotide Sequence: 462 bp     [Download]
>gi|190894340|ref|NC_010997.1|:1041417-1041878 Rhizobium etli CIAT 652 plasmid pC, complete sequence
ATGCTTCAACGACGTGGTTTTTTGATGATGCTCGGCATGACAGGCTTGATTTCCGGCTGCGTGGGCGGTC
CGCCAAAATCCTCGACCGTGACCGTCAAGGCGACGGGACAGGCGGGAATGAATCTTGCCGCTGATGGCGG
AGATCGCCCGGTGACCGTGCTCGTCCTCAGGCTCAAGGATGTCGGAAAGTTCAATTCTGCCGATATTTTC
GCCCTCCAGTCCGACCCTGCTTCCGCACTCGGGGCAGACCTTATCGGCTCCGACCAATTGACGGTCTCTC
CCGGCGGATCGGCGACCAAGACGGTGGCGTTCCCGCCGGAAGCAACGTTCCTCGGGGTGGTCGCCTTTTT
CAGGACGCCGGGCGGCCGTGTCTGGCGACAGGCGGTCCCGATCAAGCCGGAATCGACGGTGACGGCGAAT
GTAGCATTGAGTAGCGGCGGCATGGCGCTCGCGCTCGCCTGA