SecReT6
Protein ID: 190895275
SecReT6 ID291
T6SS typei3
Gene symbol-
Locus tagRHECIAT_PC0000948
StrainRhizobium etli CIAT 652
Repliconplasmid pC [GenBank: NC_010997] [Browse all T6SS(s) in this replicon]
Location [Strand]1041896..1043230 [+]
Producthypothetical protein
NoteTssK
UniProt IDB3Q4B1
KEGG IDrec:RHECIAT_PC0000948
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.50E-110, Aligned region: 19..442
Protein Sequence: 444 a.a.     [Download]
>gi|190895275|ref|YP_001985568.1| hypothetical protein RHECIAT_PC0000948 [Rhizobium etli CIAT 652]
MTDTNKVLWSEGLFLRTQHFQQQDRYTEALIRGALQAGRLQTFGFRSLTLDAAQLEAGRVAVLSARGIFP
DGTPFSIPETMDAPVPLTVTREMGAGVVQLALPLEPPGGACFDAAHSEPTGARYKGQIERVRDAVHGGAD
PEEIEIARPQALLLSPVQTTGGYTAMPVAQVNGLLADGSVAMGENFLPPALTTGAVAFYGQLMQEVITGL
DRIAEAHGKMVLGGAGRSVENLLVLDLANTARPRLAHMLPQEVFHPAELFLELSGLAGRMATYGSGSRRL
TELPTYEHMAPGPAFAALADTLRSLLLSLRYVEPKSRALPVLKHATNIWKVRVDNPELLTASRIVVRVGC
DMSEDALRKIFVDQVTVGAADEFEALWKSRLPGIRLKPLHSQPREIPYDGDRLCLELDQRSEHWESLLRS
PGFVIGVSGVLPSEPQVDCYSVNR
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|190894340|ref|NC_010997.1|:1041896-1043230 Rhizobium etli CIAT 652 plasmid pC, complete sequence
ATGACGGATACGAATAAGGTGCTCTGGTCCGAGGGTCTCTTCCTTCGGACGCAGCATTTTCAGCAGCAAG
ACCGGTATACCGAGGCCCTGATACGCGGCGCGCTGCAGGCGGGAAGGTTGCAGACCTTCGGCTTTAGATC
CCTCACGCTGGATGCCGCACAGCTTGAAGCAGGCCGCGTTGCCGTCTTGTCGGCGCGCGGCATTTTTCCG
GACGGCACGCCGTTTTCCATTCCCGAAACGATGGATGCGCCGGTGCCATTGACCGTCACCCGCGAAATGG
GTGCGGGGGTGGTGCAGCTTGCCCTGCCGCTTGAACCCCCGGGCGGCGCTTGCTTCGATGCCGCTCATAG
CGAGCCGACCGGAGCGCGCTATAAGGGACAGATCGAACGCGTGCGTGACGCCGTGCACGGTGGCGCCGAT
CCCGAAGAGATCGAGATCGCCCGTCCTCAAGCCCTGCTCTTGTCGCCAGTGCAGACGACCGGCGGCTATA
CCGCGATGCCGGTAGCGCAGGTCAACGGGCTGCTGGCCGACGGCAGCGTCGCGATGGGGGAAAACTTTCT
GCCGCCAGCCCTGACGACCGGCGCCGTGGCCTTCTACGGCCAGTTGATGCAGGAGGTGATAACCGGGCTC
GACCGCATTGCCGAAGCACATGGCAAGATGGTTCTTGGTGGCGCCGGCCGCAGCGTGGAAAATCTGCTGG
TCCTCGATCTTGCCAACACGGCGCGTCCGCGGCTGGCCCATATGCTTCCCCAGGAGGTTTTTCACCCGGC
TGAACTCTTTCTCGAACTGAGTGGACTTGCGGGGCGAATGGCGACCTACGGCTCCGGCTCCCGTCGGCTG
ACCGAGCTTCCGACCTATGAGCACATGGCGCCGGGACCTGCCTTTGCGGCGCTCGCCGATACATTGCGTT
CGCTGCTGCTCAGCCTGCGTTATGTCGAGCCGAAGTCGCGGGCGCTTCCGGTGCTCAAACATGCGACCAA
CATCTGGAAGGTTCGTGTCGACAATCCCGAATTGCTGACCGCCAGTCGCATTGTCGTGCGGGTCGGATGC
GACATGTCCGAGGACGCGCTGCGCAAAATCTTCGTCGATCAGGTGACGGTGGGTGCAGCCGACGAATTTG
AGGCCCTGTGGAAGTCACGACTGCCGGGCATCCGTTTGAAGCCGCTCCACTCGCAGCCTCGCGAGATTCC
CTATGACGGTGACCGTCTCTGCCTTGAGCTCGATCAACGCAGCGAGCACTGGGAATCCCTTCTGCGCTCG
CCGGGCTTCGTCATCGGCGTGTCCGGCGTTTTGCCCAGCGAACCGCAGGTCGACTGCTATTCGGTTAACA
GGTAG