SecReT6
Protein ID: 190895276
SecReT6 ID291
T6SS typei3
Gene symbol-
Locus tagRHECIAT_PC0000949
StrainRhizobium etli CIAT 652
Repliconplasmid pC [GenBank: NC_010997] [Browse all T6SS(s) in this replicon]
Location [Strand]1043235..1044560 [+]
Producthypothetical protein
NoteTssL
UniProt IDB3Q4B2
KEGG IDrec:RHECIAT_PC0000949
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.30E-54, Aligned region: 44..249
OmpA [PF00691], Evalue: 4.30E-15, Aligned region: 329..431
Protein Sequence: 441 a.a.     [Download]
>gi|190895276|ref|YP_001985569.1| hypothetical protein RHECIAT_PC0000949 [Rhizobium etli CIAT 652]
MASEDPFGLSGDKGRTRIRPPPSASARQLPAGGILARGARSHPNRLISAFAKLLEFAPELESALPPSNPD
VLRTRLMEELVSARDAAVASGSALARADSAAWAVASLLDDLALNTPWGGASAWPRQPLVVMLRGDVDAGA
QFFARLEELERHPGRDQELLELYYFCLALGFRGKYRVPGRAGDRSISAVRAAAARFLRDADAEAAPLSPR
WEGVAAPDEPSRFAVPIWVLAVVAAALSTAIYMLLSMRLDTKAEELATLVRALPPPERAEIYRPEKRTPP
PNAPPVEPVIIQLLPEFRAAAPASLLPALKGNENASSVTLLLQSSTPELFQSARPELTKGFEPLVASIAT
VLKQNAELIGGITITGHTDNVPLQASNPLSNNQRLSEARAATIASLLAASGVPAGQLKSQGRAATEPLAG
NDSREGRAANRRIEILIQKRL
 
Nucleotide Sequence: 1326 bp     [Download]
>gi|190894340|ref|NC_010997.1|:1043235-1044560 Rhizobium etli CIAT 652 plasmid pC, complete sequence
ATGGCAAGTGAGGATCCATTCGGTCTTTCGGGCGATAAGGGTCGTACACGCATCCGCCCCCCGCCCTCGG
CGAGCGCAAGACAGCTCCCTGCTGGCGGAATTCTGGCAAGAGGGGCACGGTCTCATCCGAACAGACTGAT
CAGTGCCTTCGCAAAGTTGCTCGAATTCGCACCGGAACTCGAAAGTGCATTGCCACCGAGCAATCCGGAC
GTGCTGCGAACGAGACTGATGGAAGAGCTTGTTTCAGCGCGCGACGCCGCGGTGGCGTCGGGGTCGGCCC
TCGCGCGGGCGGACTCGGCTGCCTGGGCTGTTGCCTCGCTTCTCGACGATCTGGCGCTGAACACGCCCTG
GGGTGGGGCAAGCGCGTGGCCGCGCCAGCCGCTGGTCGTCATGCTCCGCGGCGACGTCGACGCCGGAGCG
CAGTTTTTTGCCAGACTGGAAGAATTGGAACGCCATCCAGGTCGTGATCAGGAACTACTGGAGCTTTATT
ATTTCTGTCTGGCGCTTGGTTTTCGCGGCAAGTACCGTGTGCCTGGCCGTGCGGGCGACCGCTCGATCAG
CGCCGTTCGCGCCGCCGCGGCTCGTTTCCTGCGTGACGCCGATGCAGAAGCTGCGCCGCTCTCGCCGAGA
TGGGAGGGCGTTGCGGCGCCTGACGAGCCATCCAGATTTGCCGTGCCGATCTGGGTCCTTGCCGTCGTTG
CTGCAGCGCTGTCGACGGCAATCTACATGTTGTTGTCGATGCGCCTCGATACCAAGGCCGAGGAACTCGC
AACGCTGGTGCGGGCACTGCCGCCGCCTGAACGGGCGGAAATATATCGTCCCGAGAAGCGGACGCCGCCG
CCGAACGCCCCCCCCGTAGAGCCCGTTATCATCCAATTGCTGCCGGAATTCCGCGCCGCAGCCCCCGCTT
CCCTGCTGCCGGCCCTGAAGGGAAATGAAAACGCCTCTTCCGTCACGCTTCTTTTGCAGTCAAGCACGCC
GGAGCTTTTCCAGTCCGCCAGACCCGAATTGACGAAGGGCTTTGAACCCCTCGTTGCCTCCATCGCAACG
GTTCTCAAGCAGAATGCGGAGCTGATCGGCGGCATCACCATCACCGGGCACACTGACAATGTCCCGCTGC
AAGCGAGCAATCCGCTGTCCAACAACCAGCGCCTCTCCGAAGCCCGGGCTGCAACGATCGCCTCATTGCT
GGCAGCCTCCGGCGTGCCCGCCGGACAGTTAAAATCGCAAGGGCGCGCGGCGACAGAGCCGCTTGCCGGA
AACGATAGCCGCGAGGGTCGGGCCGCCAACCGCCGCATCGAAATTCTTATTCAAAAGAGGCTCTGA