SecReT6
Protein ID: 190895284
SecReT6 ID291
T6SS typei3
Gene symbol-
Locus tagRHECIAT_PC0000957
StrainRhizobium etli CIAT 652
Repliconplasmid pC [GenBank: NC_010997] [Browse all T6SS(s) in this replicon]
Location [Strand]1053024..1053449 [-]
Producthypothetical protein
NoteTssI
UniProt IDB3Q4C0
KEGG IDrec:RHECIAT_PC0000957
PDB IDNA
Domain hit(s) vs Pfam Phage_base_V [PF04717], Evalue: 7.30E-06, Aligned region: 42..81
DUF2345 [PF10106], Evalue: 0.0068, Aligned region: 90..137
Protein Sequence: 141 a.a.     [Download]
>gi|190895284|ref|YP_001985577.1| hypothetical protein RHECIAT_PC0000957 [Rhizobium etli CIAT 652]
MSDILERIEGVVIGLLLGFDAGVPLVVFPGNPEETALRAKSLAELTSAMVGAEVALLFEGGDPSRPLIVG
RIVDPARGAPTPNVVRDGERVQITAGERIELRCGKATIIMEKDGHITIRGTYVTSHASAANRVRGGSVNL
N
 
Nucleotide Sequence: 426 bp     [Download]
>gi|190894340|ref|NC_010997.1|:c1053449-1053024 Rhizobium etli CIAT 652 plasmid pC, complete sequence
ATGTCCGACATTCTGGAGCGGATTGAGGGAGTAGTCATCGGGCTGTTGCTGGGTTTCGATGCAGGCGTGC
CATTGGTCGTGTTTCCCGGCAATCCCGAGGAGACAGCGCTCCGTGCGAAAAGCTTGGCAGAGCTCACGTC
TGCCATGGTCGGGGCTGAGGTAGCGTTACTCTTCGAGGGCGGGGACCCGTCTCGGCCGCTGATCGTAGGG
CGCATCGTCGATCCGGCGCGCGGGGCGCCGACGCCGAATGTCGTTCGTGACGGCGAGCGTGTCCAGATCA
CAGCCGGAGAGCGGATCGAGCTTCGTTGCGGCAAAGCGACGATCATCATGGAAAAGGATGGGCACATCAC
CATCCGTGGCACTTATGTGACGAGCCACGCTAGCGCAGCCAATCGCGTCCGTGGTGGGTCGGTGAACCTC
AACTGA

Protein ID: 190895285
SecReT6 ID291
T6SS typei3
Gene symbol-
Locus tagRHECIAT_PC0000958
StrainRhizobium etli CIAT 652
Repliconplasmid pC [GenBank: NC_010997] [Browse all T6SS(s) in this replicon]
Location [Strand]1053461..1055767 [-]
Producthypothetical protein
NoteTssI
UniProt IDB3Q4C1
KEGG IDrec:RHECIAT_PC0000958
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 8.20E-77, Aligned region: 28..324
Phage_base_V [PF04717], Evalue: 3.50E-24, Aligned region: 204..215
Phage_base_V [PF04717], Evalue: 3.50E-24, Aligned region: 366..459
Gp5_C [PF06715], Evalue: 1.30E-09, Aligned region: 501..520
Gp5_C [PF06715], Evalue: 1.30E-09, Aligned region: 516..539
Gp5_C [PF06715], Evalue: 1.30E-09, Aligned region: 533..555
Gp5_C [PF06715], Evalue: 1.30E-09, Aligned region: 557..579
Gp5_C [PF06715], Evalue: 1.30E-09, Aligned region: 573..594
Gp5_C [PF06715], Evalue: 1.30E-09, Aligned region: 581..595
Gp5_C [PF06715], Evalue: 1.30E-09, Aligned region: 598..611
Gp5_C [PF06715], Evalue: 1.30E-09, Aligned region: 608..627
Gp5_C [PF06715], Evalue: 1.30E-09, Aligned region: 625..643
Gp5_C [PF06715], Evalue: 1.30E-09, Aligned region: 646..667
Gp5_C [PF06715], Evalue: 1.30E-09, Aligned region: 677..691
Protein Sequence: 768 a.a.     [Download]
>gi|190895285|ref|YP_001985578.1| hypothetical protein RHECIAT_PC0000958 [Rhizobium etli CIAT 652]
MADDRKTTVQTPLGSEALTFTHLIGRDEVSRCFAFTVGFISSDENVDALKLLGKPLSIEGESGDKKRWFS
GLVTDFRLTRIEERFAYYEAEVRPWLWLLGNSTDCRIFQNMSVVEIVEKIFSKYKAAKYEKRLQGTYEAR
EYCVQYDETDLDFVQRLLEHEGIMYFFEYGEGEHTLVLADAMNKLKPVPGYSSVKFRAEGDPVRRDEEYM
TDWVSTSSVQPGTFAHTDYDFTKPGADLMAQSAQPFSHAEAQGEHYRHPGAHLTVGRGDAVAVVRREEIQ
AAHQRIAAAGTVRGLASGCTFKLENFPRKDQNAEYVVLHADYRLFDPGYRPAAYAGEETFRATFQVAPTS
ITYRPPRNTIRPVMRGPQTATVVGPAGEEIFTDKYARVKVQFHWDRLGKKDQNSSCFVRVSQTWSGAGWG
FIQIPRIGQEVIVDFLEGDPDRPIITGRVYNGKEMPPYELPGNATQSGLKTNSSPGGGGWNELRFEDKAG
SEEVYFQAQKDHNLLVKHDRSKLVQHDQSDRIDNNAKHSVGVNLDEDVGNNKTTKVGVDRTVNIGSNDTE
TVGSNRSLTVGSNETISIGSNSTETIGASHTQTVAIVQTVTVGAARVDTVGGPETRSVGATQSNTIGASR
SVSVGAGQSHEVGSSDSWNIGSDQSVSIAGGQTSSIGKARSAKIGDDDSTEIGASRAVKVAKGSLVEVGE
DGAIKIGQDLLIEAGDSVVIKCGSASIAMKKDGTISIEGKDISINASGKFNGKASGEVTWKGSKINHN
 
Nucleotide Sequence: 2307 bp     [Download]
>gi|190894340|ref|NC_010997.1|:c1055767-1053461 Rhizobium etli CIAT 652 plasmid pC, complete sequence
ATGGCTGATGATCGCAAGACAACCGTCCAGACGCCGCTTGGATCCGAAGCGCTGACCTTCACGCATCTCA
TCGGTCGCGATGAGGTCAGCCGGTGTTTTGCCTTCACCGTCGGCTTCATCAGTTCCGATGAGAATGTCGA
CGCACTGAAGCTGCTCGGAAAACCCCTGTCGATAGAAGGAGAAAGCGGAGACAAGAAACGCTGGTTCAGC
GGGCTCGTCACCGATTTTCGCCTGACGCGCATCGAGGAGAGGTTTGCCTACTACGAGGCGGAGGTGCGAC
CCTGGCTTTGGCTGCTCGGCAACAGCACCGATTGCCGTATCTTCCAGAATATGAGCGTCGTCGAAATCGT
CGAGAAGATCTTCTCGAAATACAAGGCGGCAAAATACGAAAAGCGGTTGCAGGGTACCTACGAAGCGCGG
GAATACTGCGTGCAATATGACGAGACCGACCTTGACTTCGTGCAGAGGCTGCTCGAGCACGAAGGCATCA
TGTATTTCTTCGAGTATGGCGAGGGCGAACACACCCTCGTCCTGGCCGACGCCATGAACAAGCTGAAGCC
GGTGCCAGGCTATAGCAGCGTCAAGTTCCGGGCCGAGGGCGATCCCGTGCGTCGGGATGAGGAATACATG
ACGGACTGGGTTTCGACCAGTTCCGTCCAGCCCGGCACTTTTGCCCACACGGACTACGACTTCACCAAGC
CGGGCGCCGACCTCATGGCGCAATCGGCGCAACCGTTCTCTCACGCAGAGGCCCAGGGAGAGCATTATCG
CCATCCGGGCGCGCATCTGACGGTCGGCCGGGGCGATGCGGTTGCCGTCGTGCGGCGGGAGGAAATTCAG
GCGGCACATCAACGGATCGCCGCTGCCGGCACGGTGCGGGGTCTGGCTTCCGGTTGCACTTTCAAACTCG
AGAATTTCCCGCGCAAGGACCAGAACGCGGAATACGTTGTGCTGCACGCCGACTATCGCCTCTTCGATCC
GGGGTACCGACCTGCCGCCTATGCAGGGGAAGAAACCTTTCGAGCCACATTCCAGGTCGCTCCAACCTCC
ATCACTTATCGGCCGCCTCGCAACACGATAAGGCCGGTCATGCGCGGGCCCCAGACCGCGACCGTGGTCG
GTCCCGCGGGCGAGGAAATTTTCACCGACAAATATGCCCGCGTGAAAGTGCAGTTCCACTGGGATCGCCT
CGGCAAGAAGGATCAGAACAGCTCCTGTTTTGTGCGCGTGTCGCAGACCTGGAGCGGCGCTGGCTGGGGC
TTCATTCAGATTCCGCGGATCGGCCAGGAAGTGATTGTCGACTTTCTCGAAGGGGATCCTGATCGACCCA
TCATCACCGGCAGGGTCTATAACGGCAAGGAGATGCCGCCCTACGAGTTGCCGGGAAACGCCACGCAATC
CGGATTGAAGACGAATTCGTCGCCGGGAGGCGGTGGCTGGAACGAATTGCGTTTCGAAGACAAAGCCGGT
TCGGAGGAGGTCTATTTCCAGGCGCAGAAGGACCACAACCTCCTGGTCAAACACGATCGCAGCAAGCTCG
TCCAACACGACCAGTCGGATCGCATCGACAACAACGCCAAGCACTCAGTCGGCGTGAACCTCGACGAGGA
TGTCGGCAATAACAAGACGACCAAGGTGGGTGTCGACCGCACCGTCAATATCGGATCGAACGACACCGAG
ACGGTGGGATCCAATCGCTCTCTTACAGTCGGTTCCAACGAGACGATCAGTATCGGCTCAAACTCGACGG
AAACCATCGGTGCCAGTCATACCCAGACCGTCGCAATCGTCCAGACGGTGACGGTTGGCGCGGCACGCGT
CGATACCGTCGGCGGGCCGGAGACACGATCGGTCGGCGCGACGCAATCAAACACGATCGGCGCGTCCCGT
TCTGTCAGCGTCGGTGCCGGCCAGAGCCACGAAGTGGGCTCCTCGGACAGCTGGAATATCGGTTCCGACC
AGAGCGTGTCGATCGCCGGTGGGCAGACGAGCAGCATCGGCAAGGCGCGTAGCGCCAAGATCGGCGATGA
CGATTCGACGGAGATCGGCGCAAGCAGGGCGGTGAAAGTCGCCAAGGGCAGTCTTGTCGAGGTGGGCGAA
GACGGAGCGATCAAGATCGGTCAGGACCTGCTGATCGAAGCGGGGGACTCGGTCGTCATCAAGTGCGGGT
CGGCAAGCATCGCGATGAAGAAGGACGGCACGATCTCGATCGAAGGCAAGGACATTTCGATCAACGCCTC
GGGTAAATTCAATGGCAAGGCCTCGGGAGAGGTCACATGGAAGGGCAGCAAGATCAATCATAATTGA