SecReT6
Protein ID: 194288747
SecReT6 ID266
T6SS typei3
Gene symbolsciA
Locus tagRALTA_A0602
StrainCupriavidus taiwanensis LMG 19424
Repliconchromosome I [GenBank: NC_010528] [Browse all T6SS(s) in this replicon]
Location [Strand]620716..621777 [-]
Productreplication/virulence associated protein; impa-related n-terminal domain
NoteTssA
UniProt IDB3R0Z7
KEGG IDcti:RALTA_A0602
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 7.70E-16, Aligned region: 68..127
Protein Sequence: 353 a.a.     [Download]
>gi|194288747|ref|YP_002004654.1| replication/virulence associated protein; impa-related n-terminal domain [Cupriavidus taiwanensis LMG 19424]
MTRNTRAKPASMPGPDLAFPELLEPVAREKPCGDDLEYDPEFVLLMARAAPKAEAQYGNFVSEPEAVNWA
DLERDCRRLLLRTRDIRILVLWLRCRTRPGMASGLRDGLATLACMLAKWPDEIHPQLLVDGEADPAMRAN
ALAALTDPEGLMRDIRELVITGNAALRLQIRDVERSLGMPRPADALAPESVRLQLQALRQQNSPALAALD
QAAGHAAAIDRWAKANLRENGPDLSPLLKLLGMLTTSVATAPAPPAAAAAAAARACVSADCPSDKGAAGS
PCASAAAVHPDKPEDRDAALAGIRGARDWFERHEPSSPVSLLLRQAERLAGKRFDEVFQAIPAELVARWS
QDI
 
Nucleotide Sequence: 1062 bp     [Download]
>gi|188590795|ref|NC_010528.1|:c621777-620716 Cupriavidus taiwanensis LMG 19424 chromosome 1, complete sequence
ATGACCAGAAACACCAGAGCCAAGCCCGCCTCGATGCCAGGCCCCGACCTGGCCTTCCCCGAACTACTGG
AGCCGGTCGCACGCGAGAAGCCATGCGGTGACGACCTGGAATACGACCCCGAGTTCGTCCTGCTGATGGC
CAGGGCGGCGCCAAAGGCGGAGGCGCAGTACGGCAACTTCGTCAGCGAGCCCGAAGCCGTCAACTGGGCG
GATCTGGAACGCGACTGCCGGCGCCTGCTGCTGCGCACGCGCGACATCCGCATCCTGGTGCTGTGGCTGC
GCTGCCGTACCCGGCCGGGCATGGCAAGCGGCCTGCGCGACGGACTCGCGACCCTGGCGTGCATGCTGGC
GAAATGGCCGGATGAAATCCATCCGCAGTTGCTCGTCGATGGCGAGGCCGATCCCGCGATGCGCGCCAAT
GCGCTGGCAGCGCTGACGGATCCGGAAGGGCTGATGCGGGACATTCGCGAACTCGTCATCACCGGCAACG
CGGCGCTTCGGCTGCAGATCCGGGATGTCGAGCGCTCGCTCGGCATGCCGCGGCCCGCCGACGCCCTGGC
ACCGGAATCGGTACGGCTGCAGCTGCAGGCGCTGCGCCAGCAGAACAGCCCTGCCCTCGCGGCCCTGGAT
CAGGCCGCTGGTCATGCAGCGGCTATCGACCGCTGGGCCAAAGCCAATCTGCGGGAGAACGGTCCTGACT
TGAGCCCGTTGCTAAAGCTGCTTGGCATGCTGACCACCTCGGTCGCGACCGCGCCGGCACCGCCTGCCGC
TGCGGCAGCAGCGGCGGCACGAGCCTGCGTGTCTGCCGATTGCCCTTCCGATAAGGGTGCGGCCGGCAGT
CCTTGTGCCAGCGCAGCCGCCGTGCACCCGGACAAGCCGGAAGATCGCGATGCCGCGCTGGCCGGCATCC
GCGGCGCGCGTGACTGGTTCGAGCGCCACGAGCCCAGCAGTCCGGTGTCACTGCTGCTCAGGCAGGCCGA
ACGGCTGGCCGGCAAGCGCTTCGATGAGGTGTTCCAGGCGATTCCCGCCGAGCTGGTGGCGCGCTGGTCG
CAGGACATATAG