SecReT6
Protein ID: 194288749
SecReT6 ID266
T6SS typei3
Gene symbolsciC
Locus tagRALTA_A0604
StrainCupriavidus taiwanensis LMG 19424
Repliconchromosome I [GenBank: NC_010528] [Browse all T6SS(s) in this replicon]
Location [Strand]622817..624697 [-]
Productreplication/virulence associated protein; duf879
NoteTssF
UniProt IDB3R2V0
KEGG IDcti:RALTA_A0604
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 5.70E-210, Aligned region: 5..624
Protein Sequence: 626 a.a.     [Download]
>gi|194288749|ref|YP_002004656.1| replication/virulence associated protein; duf879 [Cupriavidus taiwanensis LMG 19424]
MDPQLLDYYNRELVYMRELAGEFARQHPKVARRLGMQGIEVADPYVERLIEAFCFLSARTEIKLDAEFPR
FTQRLLEVIYPNYVAPTPSIAVAQFHPSRGEGDFAHGVEVPRGTEVNAAAAPGEKTACQFRTTQPLILWP
LEITEARLTGIPPDVRGPERYVPAHVTVQGALRLRLRCTRDATFDQLPGLDHLPVYLRGDDLIASQLFEL
LHSAGVATLIGEPGTMSERPCAVTQDAVSYVGMGPGEGALPLQWNSFHGHNLLHEYFACPQRFYFFGLNQ
LAEGLSRIRGKEAEIVVLLSKPPGDLTSKVDRDQFALYCTPVVNLFPKRTDRIEVTPGRAEFHLVADRQH
PLDYEIYAVRQLSGQKSQHSAGLDFQPLFATLNSDEGNHGRYFSVRRERRLISEQARKYGTRTAYVGTEL
FVSLVDQHEAPYPDALRYLSVESLVTNRDLPNLVPRNGRHDLTPAASIPVDGIGLIRPPSAPRPPYADGE
MAWRLIRLLGFNYLSLTDLEHRSGGQGLRDMLRLFVANDDLTHQGQIRSLIGANVKPVMRRLPGNGPLIY
GRGIQCQLTVDEGGFSGISPYLFGVVLEHWLARHVSVNVFTQTELHSMQRGLVHRWPVRMGGRGAV
 
Nucleotide Sequence: 1881 bp     [Download]
>gi|188590795|ref|NC_010528.1|:c624697-622817 Cupriavidus taiwanensis LMG 19424 chromosome 1, complete sequence
ATGGATCCGCAACTGCTCGATTACTACAACCGCGAGCTCGTCTACATGCGCGAGCTGGCCGGTGAATTCG
CCAGACAGCACCCGAAGGTCGCAAGACGGCTGGGCATGCAGGGCATCGAGGTGGCCGACCCCTACGTGGA
GCGCCTGATCGAGGCATTCTGCTTCCTGTCGGCGCGGACCGAGATCAAGCTTGACGCAGAGTTCCCGCGC
TTCACGCAGCGTCTGCTGGAGGTGATCTACCCCAACTATGTGGCGCCGACGCCATCGATTGCGGTCGCGC
AATTCCATCCCAGCCGCGGCGAAGGCGATTTTGCCCATGGCGTGGAGGTTCCGCGCGGCACGGAGGTCAA
CGCGGCGGCGGCGCCTGGAGAGAAGACGGCCTGCCAGTTCAGGACCACGCAGCCGTTGATACTGTGGCCG
CTTGAGATCACCGAAGCGCGGCTCACCGGCATTCCGCCCGATGTACGGGGTCCGGAGCGCTATGTGCCCG
CCCATGTGACAGTCCAGGGTGCCCTGCGCTTGCGCCTGCGCTGTACGCGAGACGCCACCTTCGATCAACT
GCCCGGCCTGGACCACCTGCCGGTCTATCTGCGCGGCGACGACCTGATCGCCTCACAACTGTTCGAACTG
TTGCACAGCGCCGGTGTGGCGACGCTGATCGGCGAGCCCGGGACCATGAGCGAGCGCCCCTGCGCGGTGA
CGCAGGATGCTGTCAGTTACGTGGGAATGGGACCGGGCGAAGGCGCGCTGCCCTTGCAGTGGAACAGCTT
CCACGGGCACAACCTGTTGCATGAGTACTTCGCTTGCCCGCAACGCTTCTATTTCTTCGGCCTCAACCAG
CTTGCTGAGGGCCTGAGCCGGATCCGCGGCAAGGAAGCCGAGATCGTCGTGCTGCTGTCGAAGCCGCCCG
GGGATCTGACCAGCAAGGTCGACCGCGACCAATTCGCGCTGTATTGCACACCGGTGGTCAATCTGTTTCC
GAAGCGCACCGATCGCATCGAGGTCACGCCGGGGCGCGCCGAATTTCATCTGGTTGCCGACCGCCAGCAT
CCGCTGGACTACGAAATCTATGCCGTCAGGCAGCTTTCGGGCCAGAAGTCCCAGCACAGTGCCGGCCTGG
ACTTCCAGCCGCTCTTTGCCACGCTGAACAGTGACGAGGGCAATCACGGCCGGTACTTTTCCGTGCGGCG
CGAGCGTCGGCTGATCTCTGAGCAGGCACGCAAGTACGGCACGCGCACGGCATACGTCGGCACCGAGCTG
TTCGTATCCCTGGTGGACCAGCATGAGGCGCCTTACCCGGATGCCTTGCGCTATCTTTCGGTGGAGTCGC
TGGTCACCAATCGCGACTTGCCCAATCTGGTACCGCGCAATGGCCGGCACGACCTGACCCCGGCGGCTTC
CATCCCCGTGGACGGCATCGGTCTGATCCGGCCGCCGTCGGCACCCCGGCCACCGTACGCCGACGGCGAA
ATGGCCTGGCGCCTGATACGGTTGCTGGGCTTCAACTACTTGTCCCTGACCGACCTGGAGCACCGCTCGG
GCGGCCAAGGCCTGCGCGACATGCTGCGGCTGTTCGTAGCGAACGACGATCTCACGCACCAGGGGCAGAT
TCGGAGCCTGATCGGCGCGAACGTGAAGCCGGTCATGCGTCGGCTACCCGGCAATGGCCCGTTGATCTAT
GGCCGCGGTATCCAGTGCCAGCTCACCGTGGACGAAGGCGGCTTCTCCGGCATCAGCCCGTACCTGTTCG
GCGTAGTGCTGGAGCATTGGCTGGCGCGCCACGTCTCGGTCAATGTCTTCACCCAAACCGAACTGCACTC
CATGCAACGCGGCCTGGTGCATCGTTGGCCCGTGCGCATGGGCGGCCGCGGCGCCGTGTAG