SecReT6
Protein ID: 194288753
SecReT6 ID266
T6SS typei3
Gene symbolsciH
Locus tagRALTA_A0608
StrainCupriavidus taiwanensis LMG 19424
Repliconchromosome I [GenBank: NC_010528] [Browse all T6SS(s) in this replicon]
Location [Strand]629117..629650 [+]
Productreplication/virulence associated protein; duf770
NoteTssB
UniProt IDB3R2R0
KEGG IDcti:RALTA_A0608
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.50E-61, Aligned region: 11..164
Protein Sequence: 177 a.a.     [Download]
>gi|194288753|ref|YP_002004660.1| replication/virulence associated protein; duf770 [Cupriavidus taiwanensis LMG 19424]
MSVVNSSQKFIARNRAPRVQIEYDVEVYGSEKRIELPFVMGVLADLSGKPAEPLPAVADRKFLEIDIDNF
DERMKAMKPRVAFAVPNTLSGDGQLMVDMTFESIEDFSPAAVAGKVDALRQLLEARTQLANLQTYMDGKS
GAESLINQLLQDPALLQSLAKAPKPGVGDDEPQSPQS
 
Nucleotide Sequence: 534 bp     [Download]
>gi|188590795|ref|NC_010528.1|:629117-629650 Cupriavidus taiwanensis LMG 19424 chromosome 1, complete sequence
ATGTCTGTTGTGAACAGTTCGCAGAAATTCATCGCGCGCAATCGCGCGCCGCGCGTGCAGATCGAGTACG
ACGTCGAAGTCTATGGCTCGGAGAAACGTATCGAGCTGCCCTTCGTGATGGGCGTGCTGGCCGACTTGTC
GGGCAAGCCGGCCGAGCCGCTGCCGGCGGTGGCCGATCGCAAGTTCCTCGAGATCGATATCGACAACTTC
GACGAGCGCATGAAGGCCATGAAGCCGCGCGTGGCGTTTGCGGTGCCCAATACGCTCTCCGGCGACGGCC
AACTCATGGTCGACATGACATTCGAGAGCATCGAAGATTTCTCCCCCGCGGCGGTAGCCGGAAAGGTCGA
TGCACTCAGGCAACTGCTCGAAGCCCGCACCCAGCTCGCCAACCTGCAGACCTACATGGATGGCAAGTCG
GGCGCCGAGTCGCTGATCAACCAGTTGCTGCAGGATCCCGCGCTGCTGCAGTCGCTTGCCAAGGCGCCAA
AGCCCGGGGTAGGTGACGACGAACCTCAATCGCCGCAGTCCTGA