SecReT6
Protein ID: 194288754
SecReT6 ID266
T6SS typei3
Gene symbolsciI
Locus tagRALTA_A0609
StrainCupriavidus taiwanensis LMG 19424
Repliconchromosome I [GenBank: NC_010528] [Browse all T6SS(s) in this replicon]
Location [Strand]629700..631193 [+]
Productreplication/virulence associated protein; duf877
NoteTssC
UniProt IDB3R2R1
KEGG IDcti:RALTA_A0609
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.60E-194, Aligned region: 65..491
Protein Sequence: 497 a.a.     [Download]
>gi|194288754|ref|YP_002004661.1| replication/virulence associated protein; duf877 [Cupriavidus taiwanensis LMG 19424]
MASVQQAQQQALASADHSDFAALISREFSPKTDQAREAVDLAVKTLAEQALASSFTISDDAYKSIEAIIG
AIDKKLSEQINLILHHEDFQKLESAWRGLHHLVSNTETDDKLRIRMMDVSKEDLRRTLRRYKGIGWDQSP
FFKRIYEEEYGQLGGEPYGCLVADYYFDHTPPDVELLGSLAKISAAAHAPFIAGASPSVLQMDSWQELAN
PRDLSKIFQNLEYAPWNSLRNSEDARYVGLAMPRFLSRLPYGIKTNPVDEFDFEEDTDGADHRKYVWSNA
AYAMAVNINRSFKLYGWCTLIRGVESGGVVENLPCHTFPTDDGGIDIKCPTEIAISDRREAELSKNGFIS
LVHRKNTDYAAFIGAQSMQKPAEYYDADATANANLSARLPYLFACSRFAHYLKCIVRDKIGAFKEREDMQ
RWLNEWIMNYVDADPANSSQETKARRPLAAAEVVVEETEGNPGYYSAKFFLRPHFQLEGLTVSLRLVARL
PSVKDAA
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|188590795|ref|NC_010528.1|:629700-631193 Cupriavidus taiwanensis LMG 19424 chromosome 1, complete sequence
ATGGCCTCCGTCCAACAAGCACAACAGCAAGCGCTCGCGAGCGCTGACCATTCCGACTTCGCCGCGCTGA
TCAGCCGCGAATTCTCGCCCAAGACCGACCAGGCGCGCGAGGCCGTCGACCTCGCCGTCAAGACCCTGGC
CGAGCAGGCGCTCGCCAGCTCGTTCACCATCAGCGATGATGCCTACAAGAGCATCGAAGCCATCATCGGC
GCCATCGACAAAAAGCTGTCCGAGCAGATCAACCTGATCCTGCACCATGAGGACTTCCAGAAGCTGGAGT
CTGCCTGGCGCGGCCTGCACCACCTGGTCTCGAACACCGAAACCGACGACAAGCTGCGCATCCGCATGAT
GGACGTGTCAAAGGAAGACCTGCGCCGGACCCTGCGCCGCTACAAGGGCATCGGCTGGGACCAGAGCCCG
TTCTTCAAGCGCATCTATGAAGAAGAGTACGGCCAGCTTGGTGGCGAGCCATACGGCTGCCTGGTGGCCG
ACTACTACTTCGACCACACGCCGCCCGACGTCGAACTCCTTGGCTCGCTGGCCAAGATCTCGGCGGCGGC
TCATGCCCCGTTCATTGCCGGCGCCTCGCCGTCTGTGCTGCAGATGGATTCGTGGCAGGAGCTGGCCAAT
CCGCGCGACCTGTCCAAGATATTCCAGAACCTGGAATATGCGCCGTGGAACAGCCTGCGCAACTCGGAAG
ACGCCCGCTATGTCGGCCTCGCCATGCCGCGTTTCCTGTCGCGTCTTCCCTACGGCATCAAGACCAATCC
GGTCGATGAATTCGACTTCGAAGAAGACACCGACGGTGCGGATCACCGCAAGTACGTTTGGAGCAATGCC
GCGTACGCCATGGCGGTCAACATCAACCGCTCTTTCAAGCTCTATGGCTGGTGCACGCTGATCCGAGGCG
TCGAAAGCGGCGGCGTGGTCGAGAACCTGCCGTGCCATACCTTCCCCACCGACGATGGTGGCATCGACAT
AAAGTGCCCGACCGAAATCGCCATCTCGGACCGCCGTGAAGCCGAACTGTCGAAGAACGGCTTTATCTCG
CTGGTGCACCGCAAGAACACCGACTACGCAGCGTTCATCGGTGCCCAGTCGATGCAGAAGCCAGCCGAGT
ACTACGACGCCGATGCGACCGCCAACGCCAACCTGTCGGCACGCCTGCCGTATCTGTTCGCCTGCTCTCG
CTTTGCCCATTACCTGAAGTGCATCGTGCGCGACAAGATCGGTGCCTTCAAGGAGCGCGAGGACATGCAG
CGCTGGCTCAACGAATGGATCATGAACTACGTCGATGCCGACCCGGCCAACTCGTCGCAGGAGACCAAGG
CCCGCCGACCGCTGGCGGCAGCCGAGGTGGTCGTCGAGGAAACGGAAGGCAACCCCGGCTACTACAGCGC
CAAGTTCTTCCTGCGTCCGCACTTCCAGCTCGAGGGCCTGACCGTCTCGCTGCGCCTGGTGGCGCGCCTG
CCGTCGGTCAAGGACGCCGCCTGA