SecReT6
Protein ID: 194288755
SecReT6 ID266
T6SS typei3
Gene symbolsciK
Locus tagRALTA_A0610
StrainCupriavidus taiwanensis LMG 19424
Repliconchromosome I [GenBank: NC_010528] [Browse all T6SS(s) in this replicon]
Location [Strand]631322..631807 [+]
Producthcp-related (hemolysin-coregulated protein) protein; replication/virulence associated protein; duf796
NoteTssD
UniProt IDB3R2R2
KEGG IDcti:RALTA_A0610
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.60E-44, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|194288755|ref|YP_002004662.1| hcp-related (hemolysin-coregulated protein) protein; replication/virulence associated protein; duf796 [Cupriavidus taiwanensis LMG 19424]
MAQDIFLKINGIDGESQDASHKNEIEVLAWDWSIEQQSTMHAGSGGGAGKATVSDLSFEHFIDRASPNLM
KYCLTGKHINEAVLVVRKAGGNPLEYLKLTMTDVIVTRVSPKGSVDDEVRMREQVALSFSRVKQEYVVQN
AQGGSGGAVTAGYDIKGNKEA
 
Nucleotide Sequence: 486 bp     [Download]
>gi|188590795|ref|NC_010528.1|:631322-631807 Cupriavidus taiwanensis LMG 19424 chromosome 1, complete sequence
ATGGCACAGGACATTTTCCTGAAGATCAACGGCATCGATGGCGAGTCGCAGGATGCCTCGCACAAGAATG
AAATCGAAGTGCTGGCCTGGGACTGGAGCATCGAGCAACAGTCCACCATGCACGCGGGCAGCGGCGGCGG
CGCCGGCAAGGCCACCGTGTCGGACCTGTCCTTCGAGCACTTCATCGATCGCGCTTCGCCCAACCTGATG
AAGTACTGCCTGACCGGCAAGCACATCAACGAGGCGGTGCTGGTGGTGCGCAAGGCAGGCGGCAATCCGC
TCGAATACCTGAAGCTCACCATGACCGACGTCATCGTCACCAGGGTGAGCCCCAAGGGCTCGGTGGATGA
CGAAGTGCGCATGCGCGAGCAGGTGGCGCTGTCGTTCTCCAGGGTCAAGCAGGAGTATGTGGTGCAGAAC
GCCCAGGGCGGCAGCGGCGGGGCGGTGACCGCGGGCTACGACATCAAGGGCAACAAGGAAGCCTGA