SecReT6
Protein ID: 194288756
SecReT6 ID266
T6SS typei3
Gene symbolvrgS
Locus tagRALTA_A0611
StrainCupriavidus taiwanensis LMG 19424
Repliconchromosome I [GenBank: NC_010528] [Browse all T6SS(s) in this replicon]
Location [Strand]631938..634544 [+]
Productreplication/virulence associated protein; vgr-related
NoteTssI
UniProt IDB3R2R3
KEGG IDcti:RALTA_A0611
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.10E-77, Aligned region: 42..360
DUF2345 [PF10106], Evalue: 2.10E-42, Aligned region: 639..793
T6SS_Vgr [PF13296], Evalue: 1.30E-32, Aligned region: 504..612
T6SS_Vgr [PF13296], Evalue: 1.30E-32, Aligned region: 742..761
Phage_base_V [PF04717], Evalue: 3.00E-18, Aligned region: 399..492
Protein Sequence: 868 a.a.     [Download]
>gi|194288756|ref|YP_002004663.1| replication/virulence associated protein; vgr-related [Cupriavidus taiwanensis LMG 19424]
MSALNNLKNLAVGRNRTVSVSSAAIPDLLGQPQLEFVRISGHEGLSELFTYKVDLRAVSPAAEQYLAETD
PDAMIGREMTVTIELDGMGTGLLGGVGPGHREITGVISDIEHVGGVAENRMYRFTLRPWLWLATQTSDFK
PFQKKTVIEILDEVLADYPFSVEKRLDTSVYPKLDWEVQHGETDAHFIQRLTEEYGITYFFEHDGGHHRL
ILAAESGAYRAFPSEAYRTLPLYPRGFKIDQEHLVRFDPVNRLRTGKVTLNDYDPRKPRADLTTGNSQPR
DTSFADFERYEYPGDYIDPAVGEMRARIRMEERRSRGRRARGVGALRGVAAGCTYLVSNHSNPAMNREYL
VTGATLDLEDVGGESGSGQQFSCRVAFEAHPTDEVFRPPRTVGKPYVAGVQRAVVTGPKNQEIWCNDHGN
VIIQFEWDRYGKYDENSSPWIRVVNGWSGDQFGAMHIPRIGQEVIVAFINGDPDCPVIVGRAPNQLNLPP
WALPGQHALSGIRSKELFGGRHNHLLLDDTQDQIQAQLSSDHQASQLNLGYLTGVPDHAGRKDRHGEGFD
LRTDGHGTIRGAKGLFVTAEGQVGAMGGHLSRDEFIRCMEAALEAAKSLGDYGHAHEGLAADTDPQAELV
RAVREWDAGANNRKDAPGEGGRPLIGAYAPAGMALATPKILTTYAGKHIDTVSRLNQQMTAGQQFVVNAG
QGIGFFAHSGELRGIAHQGNLVLQAQKSSIEANAWQNVVVTATDGNIVLNAGKSLSLMTADGAGIRIGGG
KVEIHGPGGIVLHTSDFDIVGPSRLSGPLPQFSQGEAGRKFLLKAGELERPVANAPYQIVKADGTVVEGV
TNAAGETAQSASELIEAVSVKIFAPKLY
 
Nucleotide Sequence: 2607 bp     [Download]
>gi|188590795|ref|NC_010528.1|:631938-634544 Cupriavidus taiwanensis LMG 19424 chromosome 1, complete sequence
ATGAGTGCGCTAAACAACCTGAAGAACCTGGCCGTTGGGCGGAATCGCACCGTCAGCGTCTCCAGCGCGG
CGATTCCCGATCTGTTGGGACAGCCTCAGCTGGAGTTCGTGAGGATCTCAGGCCATGAGGGATTGAGTGA
ACTCTTCACCTATAAGGTAGACCTGCGCGCGGTCTCGCCTGCCGCGGAACAGTACCTTGCCGAGACGGAT
CCCGATGCGATGATCGGCCGCGAGATGACTGTCACCATCGAACTCGATGGCATGGGCACCGGCCTGTTGG
GTGGGGTGGGGCCTGGACATCGCGAGATCACCGGCGTCATCTCCGACATAGAGCATGTCGGCGGCGTGGC
GGAGAATCGCATGTACCGGTTCACGCTGCGCCCCTGGCTGTGGCTCGCGACGCAGACGTCGGATTTCAAG
CCTTTCCAGAAGAAGACGGTGATCGAGATCCTCGACGAGGTGCTTGCCGACTACCCGTTCTCGGTGGAGA
AGCGCCTCGATACCTCAGTGTACCCGAAGCTCGACTGGGAGGTGCAGCATGGCGAGACCGATGCGCATTT
CATCCAGCGCCTGACCGAAGAGTATGGCATTACATATTTCTTCGAGCATGACGGCGGACACCATCGGCTG
ATCCTGGCCGCCGAGTCGGGCGCGTACCGCGCGTTTCCCAGCGAAGCCTATCGCACGCTGCCGCTCTATC
CGCGTGGCTTCAAGATCGATCAGGAGCATCTGGTCCGCTTCGATCCGGTCAACCGGCTGCGCACGGGCAA
GGTGACGCTGAACGACTACGATCCGCGCAAACCGCGCGCGGACCTGACCACCGGCAACAGCCAGCCGCGC
GACACCAGCTTTGCCGATTTTGAACGCTACGAGTACCCGGGCGACTACATCGACCCGGCGGTGGGCGAAA
TGCGCGCGCGGATTCGCATGGAAGAACGCCGCTCACGCGGCCGGCGCGCACGTGGCGTGGGTGCGCTGCG
CGGAGTGGCGGCGGGCTGCACCTACCTGGTGAGCAATCACAGCAACCCGGCGATGAACCGCGAGTACCTG
GTGACCGGTGCGACGCTGGACCTGGAGGATGTCGGCGGCGAATCCGGTAGCGGGCAACAGTTTTCGTGCC
GCGTTGCCTTTGAAGCCCACCCCACCGATGAAGTCTTCCGCCCCCCGCGCACTGTCGGCAAACCATACGT
GGCCGGCGTGCAGCGGGCGGTGGTGACCGGCCCGAAGAACCAGGAGATCTGGTGCAACGATCACGGCAAC
GTGATCATTCAATTCGAATGGGACCGCTACGGGAAGTACGACGAGAACTCGTCGCCATGGATCCGGGTGG
TCAACGGCTGGTCGGGCGACCAGTTCGGCGCGATGCATATTCCGCGGATCGGGCAAGAGGTCATTGTTGC
CTTCATCAACGGCGATCCGGACTGTCCGGTGATTGTCGGGCGAGCGCCGAACCAGCTCAACCTGCCGCCG
TGGGCGCTGCCGGGGCAGCATGCCTTGTCGGGGATCCGCAGCAAGGAGCTGTTTGGCGGGCGCCACAACC
ACCTGTTGTTGGACGACACGCAGGACCAGATCCAGGCGCAGCTGTCCTCGGATCACCAGGCATCGCAACT
GAACCTGGGCTACCTGACCGGGGTGCCGGACCACGCCGGGCGAAAGGACAGGCATGGTGAAGGTTTTGAT
CTGCGCACCGATGGTCACGGGACCATACGGGGTGCGAAGGGGTTGTTCGTCACGGCCGAAGGGCAGGTAG
GCGCCATGGGCGGGCACCTGTCGCGCGATGAGTTCATCCGCTGCATGGAGGCGGCGCTGGAGGCGGCGAA
GTCATTGGGCGACTATGGCCATGCCCATGAAGGACTGGCCGCCGATACGGATCCGCAGGCCGAACTCGTG
CGGGCCGTGAGGGAGTGGGACGCTGGCGCCAACAACCGCAAGGACGCACCGGGTGAGGGCGGCCGGCCGT
TGATTGGTGCCTATGCGCCGGCGGGCATGGCACTGGCCACGCCCAAGATATTGACGACGTATGCCGGCAA
GCATATCGACACCGTCTCACGGTTGAACCAGCAAATGACCGCAGGGCAGCAGTTCGTTGTCAATGCGGGG
CAGGGAATCGGGTTCTTCGCACACAGCGGTGAGCTGCGCGGCATCGCGCACCAGGGCAACCTGGTTCTGC
AGGCGCAGAAATCCAGCATCGAAGCGAATGCCTGGCAGAACGTGGTGGTGACCGCCACCGACGGCAACAT
CGTCCTCAATGCGGGCAAGAGCCTGAGCCTGATGACAGCGGACGGCGCCGGTATCCGCATCGGCGGAGGC
AAGGTTGAAATCCATGGTCCTGGTGGGATCGTGCTGCATACGTCGGATTTCGACATCGTCGGGCCGTCCA
GACTGAGCGGACCGTTGCCGCAGTTTAGCCAGGGTGAAGCGGGCCGGAAGTTCCTGCTGAAGGCAGGCGA
GCTTGAGCGGCCGGTCGCCAATGCACCCTACCAGATCGTCAAGGCAGACGGCACTGTGGTGGAAGGCGTA
ACCAATGCGGCTGGCGAAACCGCGCAGTCTGCTTCGGAGCTGATCGAGGCGGTGAGCGTAAAGATATTTG
CGCCCAAGCTGTACTGA