SecReT6
Protein ID: 194288763
SecReT6 ID266
T6SS typei3
Gene symbolsciN
Locus tagRALTA_A0618
StrainCupriavidus taiwanensis LMG 19424
Repliconchromosome I [GenBank: NC_010528] [Browse all T6SS(s) in this replicon]
Location [Strand]640858..641397 [+]
Productreplication/virulence associated protein; exported protein
NoteTssJ
UniProt IDB3R2S0
KEGG IDcti:RALTA_A0618
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.80E-42, Aligned region: 26..172
Protein Sequence: 179 a.a.     [Download]
>gi|194288763|ref|YP_002004670.1| replication/virulence associated protein; exported protein [Cupriavidus taiwanensis LMG 19424]
MNRKAFLTGNRTARSMLLLGPIAVLVLSSACSSVPAQREQMKLDLAVTARDTVNPDDKGRPSPVLVRVYE
LKTASAFENADYYSLENADKTLLTQDLLARDEFILRPGESREIERKLNADTQAIGFLVGYRELGKATWRS
VYKLPPAPEAAWYRMAMPARKVKLQVSLDQQTTTISKPD
 
Nucleotide Sequence: 540 bp     [Download]
>gi|188590795|ref|NC_010528.1|:640858-641397 Cupriavidus taiwanensis LMG 19424 chromosome 1, complete sequence
ATGAATCGCAAGGCGTTTCTGACAGGGAACAGGACGGCGAGATCCATGTTGCTGCTCGGCCCGATCGCGG
TATTGGTCCTCAGCTCGGCATGTTCCAGCGTGCCCGCGCAGCGCGAGCAGATGAAGCTGGATCTGGCCGT
GACCGCCAGGGACACCGTCAACCCTGATGACAAGGGCAGGCCGTCGCCGGTCCTGGTTCGCGTTTATGAA
CTCAAGACCGCCAGCGCCTTTGAAAATGCGGACTACTACTCGCTGGAAAACGCGGACAAGACACTGCTGA
CGCAGGATCTGTTGGCACGCGACGAATTCATCCTTCGTCCCGGCGAGTCGCGTGAGATCGAGCGCAAGCT
GAATGCGGATACGCAGGCCATCGGTTTCCTGGTCGGGTACAGGGAGCTGGGCAAGGCCACCTGGAGATCC
GTCTACAAACTGCCGCCAGCCCCGGAGGCTGCGTGGTATCGCATGGCAATGCCGGCACGCAAGGTCAAGC
TGCAAGTCTCGTTGGACCAGCAGACCACTACCATTTCCAAACCTGATTGA