SecReT6
Protein ID: 194288764
SecReT6 ID266
T6SS typei3
Gene symbolsciO
Locus tagRALTA_A0619
StrainCupriavidus taiwanensis LMG 19424
Repliconchromosome I [GenBank: NC_010528] [Browse all T6SS(s) in this replicon]
Location [Strand]641402..642745 [+]
Productreplication/virulence associated protein
NoteTssK
UniProt IDB3R2S1
KEGG IDcti:RALTA_A0619
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.00E-149, Aligned region: 20..446
Protein Sequence: 447 a.a.     [Download]
>gi|194288764|ref|YP_002004671.1| replication/virulence associated protein [Cupriavidus taiwanensis LMG 19424]
MSWYNKVVWSEGLFLRPQLFQQQERYLEHYAHKRSAALSPFFWGFHHFSIDAEALSLGKLVVASAAGIFQ
DGTPFDAPAHTAVPAPLALLPEHLNQIIYLAVPIRTPNAEEMSFGDARDSLARYRAFEHELLDANSIAQG
PKLVQLADLRLRLLPERELSESWLGLPLTSVAEIRADGSARLDAALIPPVNVYAASALLQAWLTEIHGLV
HLRADAMAERLSAASMRGGDAAEVSEYLILQLLNRYEPILTHLLHAKAASPEALYMHLAALSGELSTFVR
TQTRRPAGHAAYRHDAPHLCLKPLVDDLRFLLNVVLERAAQRIDITEQSHGIRLAVLDPSEISRFPTFVL
AVAAQIPADLLQQQFPAQTKVGPSGRLAELVRSHLPGIPLQPLPVPPRQIPFHAGHVYFELSQQHPLWDQ
VAQYGGLALHVAGTFPELRMELWGVRQ
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|188590795|ref|NC_010528.1|:641402-642745 Cupriavidus taiwanensis LMG 19424 chromosome 1, complete sequence
ATGAGCTGGTACAACAAGGTCGTCTGGAGCGAAGGCTTGTTCCTGCGCCCGCAACTCTTTCAGCAACAGG
AGCGCTATCTGGAACACTACGCACACAAGCGTAGCGCCGCGCTGAGCCCGTTCTTCTGGGGCTTTCACCA
TTTCTCGATCGATGCCGAAGCGCTCTCGCTCGGCAAGCTGGTGGTAGCAAGCGCCGCGGGGATTTTCCAG
GACGGCACGCCCTTTGATGCCCCTGCTCACACGGCAGTGCCGGCACCCCTTGCGCTGCTGCCCGAGCACC
TGAATCAGATCATCTATCTTGCGGTGCCGATTCGCACGCCAAATGCGGAAGAGATGAGTTTCGGGGATGC
CAGGGACTCCTTGGCGCGTTACCGTGCCTTTGAGCACGAGCTGCTGGATGCCAATTCGATCGCACAGGGA
CCGAAACTGGTGCAGTTGGCAGACTTGCGTCTTCGGCTATTGCCGGAGAGAGAGCTTTCCGAATCCTGGC
TTGGCCTGCCGTTGACAAGCGTGGCAGAAATTCGCGCCGATGGCAGTGCCAGACTGGATGCGGCACTGAT
TCCGCCGGTCAATGTCTACGCCGCCAGCGCATTGCTTCAGGCGTGGCTTACCGAGATCCACGGCCTCGTG
CATCTCAGGGCCGATGCGATGGCGGAGCGTCTGTCTGCTGCCTCAATGCGGGGCGGGGATGCCGCCGAGG
TATCGGAATACCTGATTCTCCAATTGCTGAACCGGTATGAGCCGATTCTGACCCACTTGCTGCATGCCAA
GGCCGCGTCGCCAGAGGCGTTGTACATGCACCTGGCGGCGTTGTCCGGGGAACTGTCGACGTTCGTGCGC
ACCCAGACCCGTCGGCCTGCGGGGCATGCTGCCTATCGGCACGATGCCCCGCATCTTTGCCTCAAGCCAT
TGGTAGATGACCTGCGCTTCCTGCTCAATGTGGTGCTGGAGCGCGCCGCGCAGCGGATTGACATCACGGA
GCAGTCTCACGGGATTCGGCTGGCAGTGCTGGATCCGAGCGAGATCAGCCGCTTCCCGACTTTTGTGCTG
GCAGTCGCCGCGCAGATTCCCGCGGATCTGTTGCAGCAGCAGTTCCCGGCCCAGACCAAGGTGGGGCCAT
CCGGGCGCCTGGCGGAACTGGTTCGCTCCCATCTTCCTGGCATTCCGCTGCAGCCCCTGCCGGTGCCGCC
CCGTCAGATTCCGTTCCATGCTGGTCATGTCTATTTTGAGCTGTCGCAGCAGCATCCCCTCTGGGATCAG
GTGGCGCAGTACGGCGGGCTGGCGCTGCACGTGGCGGGGACCTTTCCTGAATTGCGCATGGAACTGTGGG
GAGTGCGGCAATGA