SecReT6
Protein ID: 194288765
SecReT6 ID266
T6SS typei3
Gene symbolsciP
Locus tagRALTA_A0620
StrainCupriavidus taiwanensis LMG 19424
Repliconchromosome I [GenBank: NC_010528] [Browse all T6SS(s) in this replicon]
Location [Strand]642742..644019 [+]
Productreplication/virulence associated protein; outer membrane protein, ompa family membrane protein
NoteTssL
UniProt IDB3R2S2
KEGG IDcti:RALTA_A0620
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.40E-66, Aligned region: 56..260
OmpA [PF00691], Evalue: 1.70E-18, Aligned region: 319..417
Protein Sequence: 425 a.a.     [Download]
>gi|194288765|ref|YP_002004672.1| replication/virulence associated protein; outer membrane protein, ompa family membrane protein [Cupriavidus taiwanensis LMG 19424]
MSQPLVSSDLPLEQQAAPHARAKDHASPRAAAGAVHQDGARRDVEHRVDEIRSKANPLLAAARPLLRALA
DMPASLRQDEVAALKRILVREAKDFQSLCDRANIRREHVLAAQYCLCTALDEAANGMSWGRHTWATNSLL
IQLHGENDGGEKVFLLLGRLLTSQSENIDVIEVIYHILSLGFLGRYAGHADGHRQLDAIRQRLLHLISGT
RESVPRDLSPHWRGADAGRLRLLRTVPVWVTVSVLALAVFGLFAWYKYQLLFRTHDLEQQILAIGKATPP
EPPRALRLAELLRDEIARGVVSVQEDATRSAITFRGDDMFGRGRADVSEKILPLLDKVAAEVSKVTGKVT
VIGHTDNVPIKTAKYPSNQALSEERAATVAEYLASKGVAKNRLEAIGKGDSQPLADNKAPVGRARNRRVE
IVVTQ
 
Nucleotide Sequence: 1278 bp     [Download]
>gi|188590795|ref|NC_010528.1|:642742-644019 Cupriavidus taiwanensis LMG 19424 chromosome 1, complete sequence
ATGAGCCAGCCACTTGTGTCGAGTGACCTTCCGCTGGAACAGCAGGCAGCCCCGCATGCCAGAGCGAAAG
ACCACGCAAGCCCGCGCGCCGCGGCGGGGGCCGTCCATCAGGACGGCGCCCGAAGGGATGTTGAGCATCG
GGTTGATGAGATCCGCAGCAAGGCAAATCCGTTGCTCGCCGCGGCTCGGCCGCTATTGCGGGCTCTGGCC
GACATGCCGGCCTCGCTGCGACAGGACGAGGTGGCTGCGCTGAAGCGCATCCTGGTGCGGGAAGCGAAGG
ACTTTCAGTCGCTCTGCGATCGCGCCAATATTCGGCGCGAGCACGTTCTGGCTGCGCAGTACTGCCTGTG
CACAGCACTGGATGAAGCGGCCAACGGCATGTCCTGGGGGCGGCATACCTGGGCGACCAATAGCTTGCTG
ATCCAGCTGCACGGCGAGAACGATGGCGGCGAGAAGGTGTTCCTGTTGTTGGGGAGGTTGCTGACATCCC
AGTCGGAGAACATCGATGTGATCGAGGTGATCTATCACATCCTCTCGCTCGGTTTTCTCGGCCGGTATGC
CGGCCACGCCGATGGTCACCGGCAACTCGACGCGATCCGGCAACGCCTGCTGCACTTGATCAGCGGAACG
CGTGAAAGCGTACCGCGGGACCTGTCACCGCACTGGCGGGGCGCAGACGCGGGGCGGCTGAGGCTGCTGC
GTACGGTCCCGGTGTGGGTCACGGTGTCGGTGCTGGCACTGGCAGTCTTTGGCCTGTTCGCCTGGTACAA
GTACCAGCTGTTGTTCCGCACCCACGACCTCGAACAGCAGATCCTCGCCATTGGCAAGGCAACGCCACCG
GAGCCGCCCAGGGCGCTGCGCCTCGCCGAGTTGCTGAGGGACGAGATTGCGCGTGGGGTTGTCAGCGTGC
AGGAGGATGCGACGCGCAGCGCCATCACGTTCCGCGGGGATGACATGTTCGGCCGCGGCCGCGCGGACGT
CAGCGAGAAGATCCTGCCGTTGCTGGACAAGGTTGCGGCAGAGGTCAGCAAGGTAACCGGCAAGGTGACC
GTGATCGGGCACACCGACAACGTTCCCATCAAGACGGCGAAGTATCCCTCGAACCAGGCGCTGTCGGAAG
AGCGTGCGGCGACCGTGGCCGAGTACCTGGCCAGCAAGGGCGTCGCAAAGAACCGGCTCGAAGCGATTGG
CAAGGGGGATTCGCAGCCGCTTGCCGATAACAAGGCGCCAGTCGGCCGGGCAAGGAATCGCCGGGTCGAG
ATCGTTGTCACGCAGTAA