SecReT6
Protein ID: 194442957
SecReT6 ID293
T6SS typei3
Gene symbol-
Locus tagSNSL254_A0303
StrainSalmonella enterica subsp. enterica serovar Newport str. SL254
Repliconchromosome [GenBank: NC_011080] [Browse all T6SS(s) in this replicon]
Location [Strand]319863..320348 [+]
Producthypothetical protein
NoteSTM0277 (e)
UniProt IDB4SV53
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF4285 [PF14113], Evalue: 4.00E-28, Aligned region: 40..141
Protein Sequence: 161 a.a.     [Download]
>gi|194442957|ref|YP_002039511.1| unnamed protein product [Salmonella enterica subsp. enterica serovar Newport str. SL254]
MNRPSFNEAWLAFRKVNHSVADVGSIIGGNVGKNITGGYFQNACPIRMSYVLNATGFPIARNSPYAKVSG
ADNKFYIYRVNDMIDYLTHTMGKPDLIVNNPKQSDFIGKKGIIVVKGHGWSNARGHVTLWNGSICSDQCH
LLNDPDNGPFVPEVGTLWILP
 
Nucleotide Sequence: 486 bp     [Download]
>gi|194442203|ref|NC_011080.1|:319863-320348 Salmonella enterica subsp. enterica serovar Newport str. SL254 chromosome, complete genome
ATGAACAGACCTTCATTCAATGAAGCGTGGTTAGCTTTTAGGAAGGTGAATCATTCCGTCGCTGATGTGG
GTAGCATTATTGGTGGAAACGTTGGGAAAAATATAACTGGTGGTTATTTTCAAAATGCCTGCCCTATTCG
AATGAGCTATGTTTTGAATGCGACAGGGTTCCCAATAGCCCGTAACTCTCCGTATGCAAAGGTTAGTGGT
GCCGATAATAAATTCTATATTTATCGCGTGAATGATATGATTGATTATCTTACTCATACTATGGGCAAGC
CTGATCTTATTGTTAATAATCCGAAACAGAGTGACTTTATCGGGAAGAAAGGAATTATCGTAGTAAAAGG
GCATGGCTGGAGCAATGCCAGAGGACACGTTACATTATGGAATGGCAGTATCTGTTCAGATCAGTGCCAC
TTATTAAATGACCCAGATAATGGACCATTTGTTCCTGAAGTTGGGACTCTGTGGATACTGCCGTGA