SecReT6
Protein ID: 194443828
SecReT6 ID293
T6SS typei3
Gene symbol-
Locus tagSNSL254_A0321
StrainSalmonella enterica subsp. enterica serovar Newport str. SL254
Repliconchromosome [GenBank: NC_011080] [Browse all T6SS(s) in this replicon]
Location [Strand]335799..339878 [+]
ProductRhs family protein
NotePAAR
UniProt IDB4SV70
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 1.60E-46, Aligned region: 390..425
RHS_repeat [PF05593], Evalue: 1.60E-46, Aligned region: 410..445
RHS_repeat [PF05593], Evalue: 1.60E-46, Aligned region: 483..511
RHS_repeat [PF05593], Evalue: 1.60E-46, Aligned region: 518..555
RHS_repeat [PF05593], Evalue: 1.60E-46, Aligned region: 582..619
RHS_repeat [PF05593], Evalue: 1.60E-46, Aligned region: 624..660
RHS_repeat [PF05593], Evalue: 1.60E-46, Aligned region: 666..696
RHS_repeat [PF05593], Evalue: 1.60E-46, Aligned region: 708..744
RHS_repeat [PF05593], Evalue: 1.60E-46, Aligned region: 751..785
RHS_repeat [PF05593], Evalue: 1.60E-46, Aligned region: 797..826
RHS_repeat [PF05593], Evalue: 1.60E-46, Aligned region: 848..883
RHS_repeat [PF05593], Evalue: 1.60E-46, Aligned region: 889..920
RHS_repeat [PF05593], Evalue: 1.60E-46, Aligned region: 981..998
RHS_repeat [PF05593], Evalue: 1.60E-46, Aligned region: 989..1017
RHS_repeat [PF05593], Evalue: 1.60E-46, Aligned region: 1033..1051
RHS_repeat [PF05593], Evalue: 1.60E-46, Aligned region: 1056..1089
RHS_repeat [PF05593], Evalue: 1.60E-46, Aligned region: 1119..1126
RHS_repeat [PF05593], Evalue: 1.60E-46, Aligned region: 1144..1165
Toxin_62 [PF15540], Evalue: 6.80E-45, Aligned region: 1063..1094
Toxin_62 [PF15540], Evalue: 6.80E-45, Aligned region: 1235..1349
PAAR_motif [PF05488], Evalue: 2.50E-15, Aligned region: 70..140
RHS [PF03527], Evalue: 4.70E-08, Aligned region: 549..566
RHS [PF03527], Evalue: 4.70E-08, Aligned region: 576..594
RHS [PF03527], Evalue: 4.70E-08, Aligned region: 654..662
RHS [PF03527], Evalue: 4.70E-08, Aligned region: 866..884
RHS [PF03527], Evalue: 4.70E-08, Aligned region: 1040..1050
RHS [PF03527], Evalue: 4.70E-08, Aligned region: 1145..1177
Protein Sequence: 1359 a.a.     [Download]
>gi|194443828|ref|YP_002039528.1| unnamed protein product [Salmonella enterica subsp. enterica serovar Newport str. SL254]
MYEAARVDDPIYHTSALAGFLIGAIIGIAIIALAAFAFFSCGFLAGLILGFMADQIASGVLQLGEAIGRS
NHHTAGKILTGSENVSTNSRPAARAVLSTVKCDNHIAEKRIAQGSENIYINSQPAARKDDHTECDAVIED
GSPNVFLGGGTQTVLEISSEIPDWLRKVVDVLFVVASLLGGLAGAWRQAAKLGTKFGTKCAAKFIGGELV
GMAVGEAISGLFSNPVDVTTGQKILLPETDFTLPGRLPVTCSRFYASHLETVGLLGRGWRLNWETSLRED
DEHITLTGVQGRELRYPKTMLTPGHQIFDPEEQLYLSRLHDGRYVLHYTDRSYYVFGDFDSDGMAYLLFM
ETPHRQRIVFGHEGGRLVRIASSSGHHLLLHRTQTPAGERLSRIELVQGGTRGNLVEYRYDDNGQLTGVV
NRAGTQVRQFAYENGLMTAHSNAAGFTCRYRWQELDGAPRVTEHDTSDGEHYRFDYDFAAGTTTVTGRQG
ESWQWWYDRETYITAHRTPGGGMYRFTYNEDHFPVNIELPGGRTVAYEYDIQNRVVKTTDPEGRVTQTQW
NGEFDEITRTALDDDAVWKTQYNAHGQPVQETDPEGRVTQYAYDEQGQMCSRTDAAGGTVVTAFDSRGQM
TRYTDCSGRSTGYDHDEDGNLTRVTDAEGKVVRISYNRLGLPETVNSPGKQQDRYTWNALGLMSSHRRIT
GSVESWRYTPRGLLAAHTDEEKRETRWQYTPEGRVAALTNGNGAQYRFSHDADGRLVREVRPDGLSRTFI
LDDSGYLTAIQTTGTQGGVRRETQQRDALGRLLRTENEHCQRTFSYNRLDQITAVTLTPTEAGQQQHRMQ
ADTVRFEYDRSGWLTAEHAGNGSIRYQRDALGNPTDITLPDGQHLTHLYYGSGHLLQTALDGLTVSEYER
DSLHRQIMRTQGQLATYSGYDDDGLLSWQRSLAPGSAPVLPGQRPARQGCVTSRDYYWNNHGEVGTIDDG
LRGSVVYSYDRSGYLTGRSGQMYDHDRYYYDKAGNLLDNEGQGPVMNNRLPGCGRDRYGYNEWGELTTRR
DQQLEWNAQGQLTRVISGNTETHYGYDALGRRIRKATYGRHTGHTARSRTDFVWEGFRLLQENVQQQGWR
TYLYDAEQPYTPVASVTGKGESRQVWYYHTDVTGTPQEVTAADGTLVWAGYIRGFGENAADISNSGAYFH
QPLRLPGQYFDDETGLHYNLFRYYAPECGRFVSQDPIGLRGGLNLYAYAPNPIRWIDPLGLAILEHQSNF
DAARRTGFENAGMTNPEDVTFSKVDPKTGTVVEFKGPNGAKVAYDAPHADMDVTAGHDKPHVGWQSAGKR
GSGGANRGNITYDGPQHPHRSDSKGDDKC
 
Nucleotide Sequence: 4080 bp     [Download]
>gi|194442203|ref|NC_011080.1|:335799-339878 Salmonella enterica subsp. enterica serovar Newport str. SL254 chromosome, complete genome
ATGTATGAAGCAGCCCGTGTGGATGACCCAATCTACCACACCAGTGCGCTCGCCGGGTTTCTTATCGGCG
CTATCATCGGCATCGCCATTATCGCGCTTGCCGCCTTTGCCTTCTTTAGCTGCGGTTTTCTTGCCGGGCT
GATTCTGGGTTTTATGGCCGATCAAATAGCCTCCGGGGTATTGCAACTGGGCGAGGCCATCGGGCGCTCC
AACCACCACACGGCAGGAAAAATCCTCACCGGTTCGGAGAATGTCAGCACCAACAGTCGCCCGGCGGCGC
GCGCGGTACTGAGTACGGTGAAATGCGATAACCATATCGCAGAAAAACGCATCGCCCAGGGGTCGGAAAA
TATCTACATTAACAGCCAGCCTGCCGCCCGTAAGGATGACCACACCGAATGCGACGCGGTGATTGAAGAC
GGTTCGCCGAATGTGTTTCTCGGCGGCGGCACACAGACGGTACTGGAAATCAGTTCTGAAATTCCGGACT
GGCTGCGCAAGGTGGTGGATGTATTGTTTGTCGTGGCGAGTCTGCTCGGCGGGCTGGCCGGGGCGTGGCG
GCAGGCGGCAAAGCTGGGGACGAAATTTGGCACTAAATGTGCCGCTAAGTTTATCGGCGGGGAGCTTGTC
GGGATGGCCGTGGGTGAGGCTATCAGCGGGCTGTTCAGCAATCCGGTGGATGTGACCACCGGGCAGAAAA
TCCTGCTGCCGGAAACGGACTTCACTCTGCCCGGTCGCCTGCCGGTCACCTGCTCGCGTTTTTACGCCAG
CCACCTGGAAACTGTGGGACTGTTGGGACGGGGCTGGCGGCTGAACTGGGAAACCAGCCTGCGCGAGGAC
GATGAACACATCACGCTGACCGGCGTACAGGGGCGGGAACTGCGTTACCCGAAAACGATGCTGACGCCCG
GCCACCAGATATTTGACCCGGAAGAACAGTTATACCTCAGCCGCCTGCATGACGGGCGTTACGTGCTGCA
TTACACCGATCGCAGCTATTACGTATTTGGTGATTTTGACAGTGACGGCATGGCATACCTGCTGTTTATG
GAGACGCCGCACCGCCAGCGCATTGTCTTCGGGCACGAAGGAGGCAGACTGGTACGGATAGCCTCCAGCA
GCGGGCATCACCTGTTACTGCACCGCACACAGACCCCGGCAGGGGAGCGGCTGTCGCGAATTGAACTGGT
GCAGGGCGGCACCCGTGGCAATCTGGTGGAGTACCGGTATGACGATAACGGTCAACTGACCGGCGTGGTG
AACCGGGCGGGAACGCAGGTGCGGCAGTTTGCTTATGAAAACGGGCTGATGACGGCGCACAGCAATGCGG
CGGGGTTCACCTGCCGCTACCGCTGGCAGGAACTCGACGGCGCGCCGCGCGTGACGGAGCACGACACCAG
TGACGGTGAACATTACCGCTTTGACTATGATTTTGCCGCAGGCACCACCACCGTCACCGGCAGGCAGGGG
GAGTCATGGCAGTGGTGGTACGACAGGGAGACGTATATCACCGCGCACCGGACGCCGGGCGGTGGAATGT
ACCGCTTCACGTACAACGAAGACCACTTCCCTGTCAACATTGAGCTGCCCGGCGGTCGCACGGTGGCGTA
TGAATATGACATCCAGAACCGGGTGGTGAAGACGACAGATCCGGAAGGCCGGGTGACGCAGACGCAGTGG
AACGGCGAGTTCGACGAAATCACGCGCACGGCGCTGGACGATGACGCTGTCTGGAAAACGCAGTACAACG
CCCACGGCCAGCCAGTGCAGGAGACGGACCCGGAAGGGCGGGTGACGCAGTACGCTTACGATGAACAGGG
GCAGATGTGCAGCCGGACGGATGCGGCGGGCGGCACGGTGGTGACGGCGTTCGACAGCCGGGGGCAGATG
ACGCGGTACACCGACTGTTCAGGGCGCAGCACAGGATATGACCACGATGAGGACGGCAACCTGACGCGGG
TGACGGACGCGGAAGGGAAGGTGGTACGCATCAGCTACAACCGACTTGGGTTGCCGGAGACGGTGAACTC
ACCGGGGAAACAGCAGGACAGGTATACCTGGAATGCGCTGGGGCTGATGAGCAGCCACCGGCGCATCACG
GGGAGCGTGGAGAGCTGGCGGTATACGCCGCGCGGTCTGCTGGCGGCGCACACGGATGAGGAGAAGCGCG
AGACGCGCTGGCAGTACACGCCGGAAGGCCGGGTGGCAGCGCTGACCAACGGCAACGGGGCGCAGTACCG
GTTCAGTCACGATGCGGACGGCAGGCTGGTGCGTGAGGTGCGCCCGGACGGACTGAGCCGTACTTTTATC
CTGGACGACAGCGGTTATCTGACGGCGATACAGACCACGGGCACGCAGGGCGGCGTGCGGCGGGAGACGC
AGCAGCGGGATGCGCTGGGCCGTCTGTTACGGACGGAGAATGAACACTGCCAGCGGACGTTCAGCTACAA
CCGGCTGGACCAGATAACGGCAGTGACGCTCACGCCCACGGAGGCGGGGCAACAGCAGCACCGGATGCAG
GCCGACACGGTGCGTTTTGAGTATGACCGCAGCGGCTGGCTGACGGCGGAGCACGCGGGGAACGGCAGCA
TACGTTATCAGCGCGACGCGCTGGGCAACCCGACGGACATCACGCTGCCGGACGGGCAGCACCTGACGCA
TCTGTATTACGGGAGCGGGCATCTGTTACAGACGGCGCTGGACGGCCTGACGGTGAGCGAGTATGAGCGC
GACAGCCTGCACCGTCAGATAATGCGCACGCAGGGGCAGCTTGCGACGTACAGCGGCTATGACGACGACG
GGCTGCTGAGCTGGCAGCGCAGCCTGGCGCCCGGCAGTGCCCCTGTTCTTCCCGGCCAGCGCCCGGCGCG
GCAGGGCTGCGTGACGTCGAGGGACTATTACTGGAACAACCACGGCGAGGTGGGCACGATTGACGACGGC
CTGCGTGGCAGCGTGGTGTACAGCTATGACAGAAGCGGTTACCTGACCGGGCGCTCAGGTCAGATGTATG
ACCATGACCGTTATTATTACGATAAGGCGGGCAACCTGCTGGATAACGAAGGGCAGGGTCCGGTGATGAA
CAACCGGCTGCCGGGCTGTGGTCGTGACCGTTACGGTTATAACGAGTGGGGCGAGCTGACCACGCGGCGC
GACCAGCAACTGGAGTGGAACGCGCAGGGGCAGCTGACGCGGGTCATCAGCGGCAACACGGAGACGCACT
ACGGCTACGATGCGCTGGGGAGGCGAATCCGCAAGGCGACGTACGGGCGGCACACGGGTCATACGGCGCG
GAGCCGGACGGACTTTGTGTGGGAGGGGTTCAGGCTGTTGCAGGAGAACGTGCAGCAGCAGGGCTGGCGG
ACCTATCTGTACGATGCGGAACAGCCGTACACGCCGGTGGCGAGCGTGACGGGAAAGGGAGAAAGCAGGC
AGGTGTGGTATTACCACACGGATGTGACGGGCACGCCGCAGGAGGTGACGGCGGCAGATGGAACGCTGGT
GTGGGCGGGGTATATCAGGGGGTTTGGAGAGAATGCGGCGGACATCAGCAACAGCGGGGCGTACTTTCAC
CAGCCGCTGCGGCTGCCGGGGCAGTATTTTGACGACGAGACAGGGCTGCATTACAATCTGTTCAGATATT
ATGCACCGGAGTGTGGCAGGTTCGTCAGTCAGGACCCGATAGGGTTAAGGGGCGGGTTAAACCTCTATGC
TTATGCGCCTAATCCGATTAGATGGATCGATCCTTTAGGACTTGCTATCCTGGAGCATCAATCTAATTTT
GATGCGGCAAGGAGAACCGGATTTGAAAATGCGGGTATGACAAACCCTGAGGATGTCACTTTCTCGAAAG
TCGATCCCAAAACTGGTACTGTTGTTGAGTTTAAAGGTCCAAATGGGGCTAAAGTTGCTTATGATGCACC
TCATGCAGATATGGATGTGACAGCAGGGCATGATAAACCACATGTTGGTTGGCAATCCGCAGGAAAAAGA
GGTTCCGGAGGAGCTAATAGAGGTAATATTACTTATGATGGCCCACAACATCCGCATCGCTCTGACTCTA
AGGGAGATGATAAATGTTAA