SecReT6
Protein ID: 194444424
SecReT6 ID293
T6SS typei3
Gene symbol-
Locus tagSNSL254_A0301
StrainSalmonella enterica subsp. enterica serovar Newport str. SL254
Repliconchromosome [GenBank: NC_011080] [Browse all T6SS(s) in this replicon]
Location [Strand]318413..318838 [+]
Producthypothetical protein
NoteSTY0301 (i)
UniProt IDB4SV51
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 141 a.a.     [Download]
>gi|194444424|ref|YP_002039509.1| unnamed protein product [Salmonella enterica subsp. enterica serovar Newport str. SL254]
MQKPILSLNSTCIVGGILWLLPVIVVHADEIVCPAVIHFSQAPIISSAEGWNVSSRAARMLNDGGFLSSG
DPKEQADLKGEDAVVDGKKGRLWEIDPEDNRRGIWFSCSYGQWAVLLARKVQGTVATCWSPDVLPAKLIC
K
 
Nucleotide Sequence: 426 bp     [Download]
>gi|194442203|ref|NC_011080.1|:318413-318838 Salmonella enterica subsp. enterica serovar Newport str. SL254 chromosome, complete genome
ATGCAGAAGCCTATTTTATCGTTGAATAGCACCTGTATTGTCGGGGGCATTCTGTGGTTACTTCCGGTAA
TAGTTGTTCATGCCGATGAGATTGTCTGCCCTGCGGTTATTCATTTTTCTCAGGCTCCAATAATTTCCTC
AGCGGAAGGATGGAATGTCTCATCCCGTGCAGCGCGTATGTTGAATGATGGTGGTTTTCTTTCGTCTGGC
GATCCCAAAGAGCAGGCAGATCTGAAAGGTGAAGATGCAGTCGTTGATGGGAAAAAGGGGCGTCTGTGGG
AGATAGACCCGGAGGATAATCGCCGGGGGATCTGGTTCTCATGTAGTTATGGACAGTGGGCTGTTCTGCT
TGCCAGAAAAGTTCAGGGAACGGTCGCGACATGCTGGAGCCCGGATGTCTTACCGGCAAAATTGATTTGT
AAATAA