SecReT6
Protein ID: 194444887
SecReT6 ID293
T6SS typei3
Gene symbol-
Locus tagSNSL254_A0307
StrainSalmonella enterica subsp. enterica serovar Newport str. SL254
Repliconchromosome [GenBank: NC_011080] [Browse all T6SS(s) in this replicon]
Location [Strand]321951..323294 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDB4SV57
KEGG IDsee:SNSL254_A0307
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 8.10E-138, Aligned region: 20..445
Protein Sequence: 447 a.a.     [Download]
>gi|194444887|ref|YP_002039515.1| unnamed protein product [Salmonella enterica subsp. enterica serovar Newport str. SL254]
MSWNDRVVWSEGQFLLPQMFQQQERYLEHVMHYRSLPLTPFFWGFSHYNIDGEALNIGKLILKEASGIFP
DGTPFNAPDHTPLPPPLTILPEHLNQQICLAVPVRAPNSEETTFDNNPESLARFSVHEHDIRDANSLGRG
AQLLQLSHLRLRLLPEKAVTGAWIGLPLTRITGLNPDGRIDIDHDLIPPIINYQASSLMCTWLSWINDLI
RMRADSLAERLTGSDNHGHEAAEVSDYLLLQILNRFEPLLTHLAKTPLAPEVLYRYLSELAGELSTYVRP
QTRRPAEYKEYKHLTPYAGLKSLVDEVQFLLNAVLIRGAQRIELKEGTYGILNAVVAPSDLADFSTLVLA
IKASMPTDVLLQHFAAQTKIGPSDRLPELIRSHLPGLALQVLPVPPRQIPFQAGYIYYDIRREGALWEHI
ARYGGMAMHTAGEFPGLETELWGVRDK
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|194442203|ref|NC_011080.1|:321951-323294 Salmonella enterica subsp. enterica serovar Newport str. SL254 chromosome, complete genome
ATGAGCTGGAATGACCGCGTAGTCTGGAGTGAAGGACAATTTTTACTGCCGCAGATGTTTCAGCAGCAAG
AGCGTTATCTGGAACACGTCATGCATTACCGCAGCCTGCCGCTGACCCCCTTTTTCTGGGGATTCAGCCA
CTACAATATTGATGGCGAAGCGCTGAACATCGGTAAACTGATACTGAAAGAGGCATCAGGGATTTTCCCT
GACGGCACGCCGTTTAACGCACCGGACCACACCCCGCTGCCGCCGCCGCTGACCATCCTGCCGGAGCACC
TGAACCAGCAGATTTGTCTGGCGGTACCGGTTCGCGCGCCGAACAGCGAAGAAACTACGTTTGACAATAA
CCCGGAATCACTGGCGCGTTTCTCGGTACATGAACACGACATCCGCGACGCCAACTCGCTGGGACGTGGC
GCGCAGTTATTACAGCTCAGTCACCTGCGCCTGCGGCTGCTGCCGGAAAAAGCGGTGACGGGCGCCTGGA
TTGGCCTGCCGTTGACCCGCATCACCGGGTTGAACCCTGACGGGCGGATAGATATCGACCACGACCTGAT
CCCGCCCATCATTAATTATCAGGCCAGTTCACTGATGTGTACCTGGCTGTCGTGGATCAACGATCTCATC
CGGATGCGGGCCGATTCGCTGGCGGAACGGCTGACAGGCAGCGACAACCACGGCCATGAAGCAGCGGAGG
TCTCCGATTACCTGCTGCTGCAAATTCTCAATCGCTTTGAGCCGCTGTTGACCCACCTGGCGAAAACGCC
GCTGGCCCCGGAAGTGTTGTATCGCTACCTGTCCGAACTGGCCGGGGAACTCTCCACCTATGTGCGTCCA
CAAACGCGACGGCCCGCTGAATACAAAGAGTACAAACACCTGACGCCCTATGCCGGGTTGAAATCGCTGG
TTGATGAGGTGCAGTTCCTGCTGAATGCGGTACTGATCCGGGGCGCGCAGCGCATCGAACTGAAAGAGGG
GACTTACGGCATCCTGAATGCGGTGGTGGCTCCTTCCGATCTTGCCGATTTCAGCACGCTGGTACTGGCG
ATAAAGGCTTCAATGCCGACCGATGTGCTACTGCAACATTTTGCCGCCCAGACCAAAATCGGGCCATCCG
ATCGCCTGCCGGAACTGATCCGCTCGCATCTGCCGGGGCTGGCTTTGCAGGTTCTGCCTGTACCACCGCG
CCAAATCCCGTTTCAGGCCGGATACATCTATTACGACATCCGCCGCGAGGGAGCATTGTGGGAACACATT
GCCCGTTACGGCGGGATGGCCATGCATACCGCCGGGGAATTTCCGGGGCTGGAGACAGAACTGTGGGGAG
TGCGCGATAAATGA