SecReT6
Protein ID: 194445579
SecReT6 ID293
T6SS typei3
Gene symbol-
Locus tagSNSL254_A0294
StrainSalmonella enterica subsp. enterica serovar Newport str. SL254
Repliconchromosome [GenBank: NC_011080] [Browse all T6SS(s) in this replicon]
Location [Strand]310602..311096 [-]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDB4SV44
KEGG IDsee:SNSL254_A0294
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 9.40E-22, Aligned region: 35..147
Protein Sequence: 164 a.a.     [Download]
>gi|194445579|ref|YP_002039502.1| unnamed protein product [Salmonella enterica subsp. enterica serovar Newport str. SL254]
MSTSRFTPANHLLPTLFDRLCDNAPYQKIDRDISVTPVQLKEIIRRDLSFLLNTISHEGDIDARRYPQAA
ASVLNYGLPPLAGSFMYEHKWDDISEAIRRAIIRFEPRLNAATLRVTPLLDKTRQGSYNTLQFEIRGQIL
TQPYPTEFLVRSALDMELSRITFF
 
Nucleotide Sequence: 495 bp     [Download]
>gi|194442203|ref|NC_011080.1|:c311096-310602 Salmonella enterica subsp. enterica serovar Newport str. SL254 chromosome, complete genome
ATGAGCACGTCTCGTTTTACACCCGCTAACCACCTGCTGCCCACCCTATTTGATCGGCTGTGTGACAATG
CCCCGTATCAGAAAATTGACCGGGATATCAGCGTCACGCCGGTACAACTGAAGGAGATCATTCGTCGGGA
TCTCTCCTTTTTGCTCAATACCATTAGCCACGAGGGTGACATCGACGCCCGGCGCTATCCGCAGGCGGCG
GCGTCAGTGCTCAACTATGGCCTGCCGCCGCTGGCGGGCAGCTTTATGTATGAGCATAAGTGGGACGATA
TCAGCGAGGCGATCCGGCGCGCCATTATCCGTTTCGAACCCCGGCTGAACGCCGCCACACTCAGGGTCAC
GCCCTTGCTCGATAAAACCCGGCAGGGTAGCTATAACACGCTACAGTTTGAAATTCGCGGACAAATTCTG
ACGCAGCCGTATCCCACGGAGTTTCTGGTACGCAGCGCGCTGGATATGGAGCTGAGCCGCATTACGTTCT
TTTAA