SecReT6
Protein ID: 194446459
SecReT6 ID293
T6SS typei3
Gene symbol-
Locus tagSNSL254_A0291
StrainSalmonella enterica subsp. enterica serovar Newport str. SL254
Repliconchromosome [GenBank: NC_011080] [Browse all T6SS(s) in this replicon]
Location [Strand]306645..307694 [-]
ProductImpA-related N- family protein
NoteTssA
UniProt IDB4SV41
KEGG IDsee:SNSL254_A0291
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.50E-18, Aligned region: 49..108
ImpA-rel_N [PF06812], Evalue: 1.50E-18, Aligned region: 222..239
Protein Sequence: 349 a.a.     [Download]
>gi|194446459|ref|YP_002039499.1| unnamed protein product [Salmonella enterica subsp. enterica serovar Newport str. SL254]
MSLTKPVSAEQPCGPDPEYDPEYLLLFSRAAPQAEAQYGDFVSTPEAVNWPEIERDARRLLTRSKDIRVL
ILLLRSRIQQAGAQGLAEMLTQLAELSVIWSDALHPQLLTGEGAPAESIEDAALARSNALAALLDHEGVM
ADIRGITLSNSAVLRLQVRDVERALSAPRPADALAPESVRQQLADLEARGALPLAAFREAQESAERLQVW
ARETLGDLAPDFSRLRQLLALLPDVVQTTTPEIPPSPAPVPDPAGTVMDNAVPARAEDVPPVNAPPGISL
PHNAEPGPIRDRNDALERLRCIRRWFEGSEPSSPTIPLLRQAERLVGKRFSEVINEIPVELLEKWDALE
 
Nucleotide Sequence: 1050 bp     [Download]
>gi|194442203|ref|NC_011080.1|:c307694-306645 Salmonella enterica subsp. enterica serovar Newport str. SL254 chromosome, complete genome
ATGTCCCTGACTAAACCGGTAAGCGCGGAACAACCCTGCGGCCCCGATCCGGAGTACGACCCGGAATACC
TGCTGCTGTTCAGTCGCGCCGCCCCCCAGGCGGAGGCGCAATATGGTGATTTTGTCAGTACACCGGAAGC
CGTGAACTGGCCGGAAATTGAACGTGATGCGCGCCGTCTGCTCACGCGCAGTAAGGATATCCGGGTGTTG
ATCCTGCTGCTGCGCAGTCGCATCCAGCAGGCTGGCGCACAGGGACTGGCGGAAATGCTCACGCAACTGG
CAGAACTGAGCGTAATCTGGTCCGATGCACTCCATCCACAGCTGCTTACCGGCGAAGGCGCACCCGCAGA
ATCTATTGAAGATGCGGCGCTGGCGCGCAGTAATGCCCTGGCGGCGCTGCTGGATCACGAAGGCGTGATG
GCAGACATTCGCGGTATCACGCTGTCAAACAGTGCCGTCCTGCGCCTGCAGGTACGGGATGTCGAGCGCG
CGTTATCCGCCCCTCGCCCGGCTGATGCGCTGGCCCCCGAATCCGTCCGCCAGCAACTGGCCGACCTCGA
AGCCCGTGGGGCATTACCGCTGGCGGCGTTTCGCGAAGCGCAGGAAAGCGCAGAACGCCTGCAAGTGTGG
GCGCGTGAGACATTAGGCGATCTGGCTCCAGATTTTTCACGCCTGCGGCAGTTGTTAGCGCTGCTGCCTG
ACGTGGTACAGACAACCACACCGGAAATCCCTCCGTCGCCAGCGCCAGTGCCAGACCCCGCAGGCACGGT
TATGGATAATGCCGTTCCGGCACGGGCAGAGGATGTGCCGCCTGTCAACGCGCCACCCGGTATATCCCTC
CCACACAATGCTGAACCGGGGCCAATTCGCGATCGTAATGATGCGCTGGAGCGCCTGCGGTGCATTCGTC
GCTGGTTTGAGGGCAGTGAACCCAGTAGCCCGACCATCCCACTGTTACGCCAGGCTGAAAGACTGGTGGG
AAAACGGTTCTCGGAGGTGATCAATGAGATCCCGGTGGAGTTGCTGGAGAAGTGGGATGCCCTGGAATGA