SecReT6
Protein ID: 194446584
SecReT6 ID293
T6SS typei3
Gene symbol-
Locus tagSNSL254_A0306
StrainSalmonella enterica subsp. enterica serovar Newport str. SL254
Repliconchromosome [GenBank: NC_011080] [Browse all T6SS(s) in this replicon]
Location [Strand]321456..321947 [+]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDB4SV56
KEGG IDsee:SNSL254_A0306
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.50E-41, Aligned region: 5..155
Protein Sequence: 163 a.a.     [Download]
>gi|194446584|ref|YP_002039514.1| unnamed protein product [Salmonella enterica subsp. enterica serovar Newport str. SL254]
MPFALLLLSGCGSSDALPDLESQRLDLSVKASDKVNPDNQKKAAPIEIRVYELKNDAAFTTADYWSLHDN
DKSVLTDDLVRRDSFILRPGEEKKLRRPLNAQTTAIGVLAGYRNLAKSVWRVTYKIPEAPEKAWYSSFIP
GKGKVQLEAELEQSAIVITERDK
 
Nucleotide Sequence: 492 bp     [Download]
>gi|194442203|ref|NC_011080.1|:321456-321947 Salmonella enterica subsp. enterica serovar Newport str. SL254 chromosome, complete genome
ATGCCTTTTGCACTGCTCCTGCTTTCCGGATGCGGCAGTAGCGATGCGTTACCTGACCTCGAATCACAGC
GACTCGACCTGAGCGTGAAAGCCTCCGATAAGGTGAATCCTGACAATCAGAAGAAGGCCGCGCCCATTGA
GATTCGTGTTTATGAACTAAAAAATGACGCCGCTTTCACGACAGCTGATTACTGGTCGCTCCATGACAAC
GACAAATCCGTCCTTACCGACGATTTAGTGCGTCGCGACAGCTTTATTTTGCGTCCCGGCGAAGAGAAAA
AACTGCGTCGCCCGCTGAATGCGCAGACCACGGCAATCGGCGTACTGGCCGGATACCGTAACCTGGCCAA
ATCGGTCTGGCGGGTAACCTACAAAATCCCGGAAGCCCCGGAAAAAGCCTGGTACAGCAGCTTCATACCG
GGGAAAGGAAAAGTGCAGTTGGAGGCGGAACTGGAACAAAGCGCCATTGTAATTACGGAACGGGATAAAT
GA