SecReT6
Protein ID: 194448663
SecReT6 ID294
T6SS typei3
Gene symbol-
Locus tagSeHA_C0308
StrainSalmonella enterica subsp. enterica serovar Heidelberg str. SL476
Repliconchromosome [GenBank: NC_011083] [Browse all T6SS(s) in this replicon]
Location [Strand]316880..317704 [-]
Producthypothetical protein
NoteTagJ
UniProt IDB4TK91
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 9.10E-46, Aligned region: 143..266
Protein Sequence: 274 a.a.     [Download]
>gi|194448663|ref|YP_002044253.1| hypothetical protein SeHA_C0308 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476]
MKKTDTLPATLSALIQEYSFAEGIQMAEQQVRENPAKALCRHSLFQLLCVAGDWSRALHQLQLCARMEAN
YTQEARLYRELVRCEMFRHTVFQGEQRPGFLLPQPVWVESLLAALACHDDTGEVDKHRNTALEAITDTGG
QWNGGAFDWASDSDSRLGPVLELVTGGVYIWLPFSQIRSLESPQPTRLTDLLWKPVNITLVNGDTHGAWL
FTRYSGSESASDALRLCRETAWQDGPGETTVRALGQKVWLTSHGDISLLDMAHCTFHAQENDGA
 
Nucleotide Sequence: 825 bp     [Download]
>gi|194447306|ref|NC_011083.1|:c317704-316880 Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 chromosome, complete genome
ATGAAAAAAACTGACACGCTTCCTGCTACCCTGTCCGCGCTGATACAGGAATACTCTTTTGCGGAGGGGA
TTCAGATGGCGGAGCAGCAGGTTCGGGAAAATCCGGCGAAAGCGCTCTGCCGCCACAGCCTGTTTCAGTT
GCTGTGTGTGGCCGGAGACTGGTCGCGGGCGCTACACCAGCTTCAGCTATGCGCCAGGATGGAGGCCAAT
TATACCCAGGAGGCCCGGCTGTACCGGGAGCTGGTTCGCTGCGAAATGTTCCGCCACACCGTTTTTCAGG
GTGAACAACGACCCGGTTTTCTTCTGCCGCAGCCCGTTTGGGTGGAGTCACTGCTGGCGGCACTCGCCTG
TCATGACGATACCGGTGAGGTTGATAAACACCGTAATACCGCACTGGAAGCCATAACAGATACTGGCGGA
CAGTGGAACGGCGGCGCATTTGACTGGGCGAGCGACAGCGATTCCCGCCTTGGCCCGGTACTTGAGCTGG
TCACCGGCGGCGTGTATATCTGGCTGCCGTTTTCGCAAATACGCTCGCTGGAATCGCCGCAACCGACGCG
CCTGACCGATCTGCTGTGGAAACCCGTTAATATCACCCTGGTGAATGGCGATACGCACGGCGCCTGGCTC
TTTACCCGTTACAGCGGTTCGGAAAGTGCATCCGACGCCCTGCGTCTGTGCCGGGAAACCGCCTGGCAGG
ACGGCCCCGGCGAAACCACCGTGCGAGCGCTGGGGCAGAAAGTGTGGCTGACCAGCCACGGCGATATCAG
CCTGCTGGACATGGCCCATTGTACCTTTCATGCTCAGGAAAACGATGGCGCATGA