SecReT6
Protein ID: 194448891
SecReT6 ID294
T6SS typei3
Gene symbol-
Locus tagSeHA_C0304
StrainSalmonella enterica subsp. enterica serovar Heidelberg str. SL476
Repliconchromosome [GenBank: NC_011083] [Browse all T6SS(s) in this replicon]
Location [Strand]312432..313481 [-]
ProductImpA-related N- family protein
NoteTssA
UniProt IDB4TK87
KEGG IDseh:SeHA_C0304
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.00E-18, Aligned region: 49..108
ImpA-rel_N [PF06812], Evalue: 2.00E-18, Aligned region: 222..239
Protein Sequence: 349 a.a.     [Download]
>gi|194448891|ref|YP_002044249.1| ImpA-related N- family protein [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476]
MSLTKPVSAEQPCGPDPEYDPEYLLLFSRAAPQAEAQYGDFVSTPEAVNWPEIERDARRLLTRSKDIRVL
ILLLRSRIQQAGAQGLAEILTQLAELSVIWSDALHPQLLTGEGASAESIEDAALARSNALAALLDHEGVM
ADIRGITLSNSAVLRLQVRDVERALSAPRPADALAPESVRQQLADLEARGALPLAAFREAQESAERLQVW
ARETLGDLAPDFSRLRQLLALLPDVVQTTTPEIPPSPAPVPDPAGTVMDNAVPARAEDVPPVNAPPGISL
PHNAEPGPIRDRNDALERLRCIRRWFESSEPSSPTIPLLRQAERLVGKRFSEVINEIPVELLEKWDALE
 
Nucleotide Sequence: 1050 bp     [Download]
>gi|194447306|ref|NC_011083.1|:c313481-312432 Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 chromosome, complete genome
ATGTCCCTGACTAAACCGGTAAGCGCGGAACAACCCTGCGGCCCCGATCCGGAGTACGACCCGGAATACC
TGCTGCTGTTCAGTCGCGCCGCCCCCCAGGCGGAGGCGCAATATGGTGATTTTGTCAGTACGCCGGAAGC
CGTGAACTGGCCGGAAATTGAACGTGATGCGCGCCGTCTGCTCACGCGCAGTAAGGATATCCGGGTGTTG
ATCCTGCTGCTGCGCAGTCGCATCCAGCAGGCTGGCGCACAGGGACTGGCGGAAATACTCACACAACTGG
CAGAACTGAGCGTAATCTGGTCCGATGCACTCCATCCACAGCTGCTTACCGGCGAAGGCGCATCCGCAGA
ATCTATTGAAGATGCGGCGCTGGCGCGCAGTAATGCCCTGGCGGCGCTGCTGGATCACGAAGGCGTGATG
GCAGACATTCGCGGTATCACGCTGTCAAACAGTGCCGTCCTGCGCCTGCAGGTACGGGATGTCGAGCGCG
CGTTATCCGCCCCTCGCCCGGCTGATGCGCTGGCCCCCGAATCCGTCCGCCAGCAACTGGCCGACCTCGA
AGCCCGTGGGGCATTACCGCTGGCGGCGTTTCGCGAAGCGCAGGAAAGCGCAGAACGCCTGCAAGTGTGG
GCGCGTGAGACATTAGGCGATCTGGCTCCAGATTTTTCACGCCTGCGGCAGTTGTTAGCGCTGCTGCCTG
ACGTGGTACAGACAACCACACCGGAAATCCCTCCGTCGCCAGCGCCAGTGCCAGACCCCGCAGGCACGGT
TATGGATAATGCCGTTCCGGCACGGGCAGAGGATGTGCCGCCTGTCAACGCGCCACCCGGTATATCCCTC
CCACACAATGCTGAACCGGGGCCAATTCGCGATCGTAATGATGCGCTGGAGCGCCTGCGGTGCATTCGTC
GCTGGTTTGAGAGCAGTGAACCCAGTAGCCCGACCATCCCACTGTTACGCCAGGCTGAAAGACTGGTGGG
AAAACGGTTCTCGGAGGTGATCAATGAGATCCCGGTGGAGTTGCTGGAGAAGTGGGATGCCCTGGAGTGA