SecReT6
Protein ID: 194450123
SecReT6 ID294
T6SS typei3
Gene symbol-
Locus tagSeHA_C0329
StrainSalmonella enterica subsp. enterica serovar Heidelberg str. SL476
Repliconchromosome [GenBank: NC_011083] [Browse all T6SS(s) in this replicon]
Location [Strand]338910..341141 [+]
ProductRhs family protein
NoteTssI
UniProt IDB4T7M3
KEGG IDseh:SeHA_C0329
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.80E-80, Aligned region: 120..428
Phage_GPD [PF05954], Evalue: 6.80E-80, Aligned region: 632..646
Phage_base_V [PF04717], Evalue: 9.30E-26, Aligned region: 466..558
Protein Sequence: 743 a.a.     [Download]
>gi|194450123|ref|YP_002044274.1| Rhs family protein [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476]
MSFVSTNNKSGIGGLTTTTPPITGESGGVTADSVAGSVADAAEAAVEQAAGSLFGALPEPSGLVKAAVAA
AQAAAAGMAQDAVSAIVSAVAGGPGAHNVTVSGSAVPPGALLFASLDGGETLSELFSYVVQLKTPDTLNL
GYVSPAANLPLKPMVGKDLCVNIELDGGGKRHISGLVTAARVVGHEGRSVTYELRMEPWLKLLTHTSDYK
AFQNKSVVDILDEVLAEYPYPVEKRLVESYPVRTWQVQYGETDFDFLQRLMQEWGIYWWFEHSEDSHTLV
LADAISAHKACPDSPLVEWHQEGLKLDKEFIHTITANESLRTGQWVLDDFDFTKPRSLLANTVANPRETG
HATYEHYEWPGDYFDKSEGEMLTRIRMEAQRSPGSRVLGGGNIRTLMTGYTFTLENYPTAEVNQEYLLMQ
TLLFVQDNAQHSGQDQHFTFSTRFELHPTREVFRPQRTVSKPHTKGPQSAIVTGPAGQEIWTDQYGRVKV
QFGWDRYGKMDENSSCWIRVSYPWAGKGFGMIQIPRIGQEVLVDFKNGDPDLPIIVGRTYNQDTMPPWGL
PGAATQSGIYSHTIGGGPTNANALRFEDKPGSEEVWLHAEKDQRIEVNNNESHWVGNNRVKVIDQSEIAT
IGAVRDHKVQYDDTSLAGGNKTIQTVKELYLAAGDSITLSCGDTVLYMSSKGEFYVTCKTFNITATDADG
QINTIKGQLDLNMDKREPKVGTFGESEKTAMAAVIKETFPPKE
 
Nucleotide Sequence: 2232 bp     [Download]
>gi|194447306|ref|NC_011083.1|:338910-341141 Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 chromosome, complete genome
ATGAGTTTTGTATCCACAAATAATAAATCCGGTATAGGAGGGCTGACGACAACCACGCCGCCGATAACCG
GAGAAAGTGGCGGTGTCACCGCAGATTCAGTCGCCGGAAGCGTGGCAGATGCGGCGGAAGCCGCCGTGGA
ACAGGCTGCGGGATCGCTGTTTGGCGCATTGCCGGAGCCATCAGGACTGGTGAAAGCCGCGGTGGCAGCG
GCGCAGGCCGCCGCCGCAGGTATGGCGCAGGATGCGGTATCGGCCATCGTCTCCGCTGTTGCAGGCGGGC
CGGGGGCGCATAATGTGACGGTCAGCGGCAGCGCCGTACCGCCGGGCGCATTACTGTTCGCCAGCCTGGA
CGGCGGCGAAACATTAAGTGAACTGTTCAGCTATGTGGTACAGCTAAAAACGCCCGACACCCTGAATCTG
GGCTATGTCTCCCCGGCGGCCAACCTGCCGCTCAAACCGATGGTGGGCAAAGATCTGTGCGTCAACATCG
AACTGGATGGTGGCGGTAAACGACATATCAGCGGGCTGGTCACGGCGGCGCGGGTGGTGGGCCATGAAGG
GCGTTCGGTTACCTATGAGCTACGTATGGAGCCGTGGCTGAAACTGCTGACCCATACCAGCGACTACAAA
GCATTCCAGAATAAAAGCGTGGTGGATATTCTGGATGAAGTGCTGGCGGAATACCCCTACCCGGTGGAAA
AGCGGCTGGTGGAAAGCTACCCGGTACGCACCTGGCAGGTGCAGTACGGTGAAACTGATTTTGATTTTCT
TCAGCGACTGATGCAGGAGTGGGGCATCTATTGGTGGTTTGAGCACAGCGAGGACAGCCACACGCTGGTG
CTGGCGGATGCCATCAGCGCCCACAAAGCATGTCCGGACTCGCCGCTGGTCGAGTGGCACCAGGAAGGGC
TGAAGCTGGACAAGGAGTTTATCCACACTATCACGGCAAACGAGAGTCTGCGGACTGGACAGTGGGTGCT
GGATGATTTCGATTTTACGAAGCCACGTTCATTGCTGGCAAACACGGTGGCAAACCCGCGTGAAACCGGT
CATGCCACCTACGAGCATTATGAGTGGCCGGGAGACTACTTCGACAAGAGTGAAGGCGAGATGCTGACGC
GCATTCGTATGGAAGCGCAGCGCAGCCCCGGCAGTCGGGTGCTGGGGGGAGGGAATATCCGCACACTCAT
GACCGGTTATACCTTCACGCTGGAAAACTATCCCACTGCCGAAGTCAATCAGGAATACCTGCTGATGCAG
ACCTTGCTGTTTGTGCAGGACAACGCGCAGCACAGCGGGCAGGACCAGCACTTTACCTTTTCCACCCGTT
TTGAACTGCACCCCACCCGCGAGGTGTTCCGCCCGCAGCGGACGGTGAGCAAACCCCACACCAAAGGGCC
GCAGAGCGCCATCGTCACCGGCCCGGCGGGCCAGGAAATCTGGACGGATCAGTACGGGCGGGTAAAGGTA
CAGTTTGGCTGGGATCGCTACGGCAAAATGGATGAAAACAGCTCTTGCTGGATACGCGTCAGCTACCCAT
GGGCGGGCAAAGGCTTCGGGATGATCCAGATCCCGCGTATCGGCCAGGAAGTGCTGGTGGATTTCAAAAA
CGGCGATCCGGATCTGCCGATCATCGTGGGGCGTACCTACAACCAGGACACCATGCCGCCGTGGGGACTG
CCGGGCGCGGCAACACAGAGCGGGATATACAGCCACACTATCGGCGGCGGACCGACCAATGCCAACGCCC
TGCGTTTTGAAGATAAACCCGGTAGTGAAGAGGTCTGGCTACATGCTGAAAAAGATCAGCGTATTGAAGT
TAATAATAATGAAAGTCACTGGGTGGGGAATAATCGGGTTAAGGTCATTGATCAGTCAGAAATAGCCACT
ATTGGCGCTGTCCGCGACCATAAAGTTCAGTATGACGATACCTCTCTGGCCGGAGGAAATAAAACCATTC
AGACGGTAAAAGAGTTATATCTGGCAGCGGGTGATTCTATTACTCTGAGTTGTGGTGACACCGTTCTGTA
CATGAGCAGTAAGGGGGAATTTTACGTAACCTGTAAAACGTTCAATATTACTGCAACAGATGCCGATGGT
CAGATTAATACTATAAAAGGGCAGCTGGATTTAAATATGGATAAAAGAGAACCCAAAGTGGGAACATTTG
GTGAGTCAGAAAAAACAGCAATGGCAGCAGTAATTAAGGAAACTTTCCCACCCAAAGAATAG