SecReT6
Protein ID: 194450746
SecReT6 ID294
T6SS typei3
Gene symbol-
Locus tagSeHA_C0311
StrainSalmonella enterica subsp. enterica serovar Heidelberg str. SL476
Repliconchromosome [GenBank: NC_011083] [Browse all T6SS(s) in this replicon]
Location [Strand]321700..322242 [+]
Producttype VI secretion protein, family
NoteTssB
UniProt IDB4TK94
KEGG IDseh:SeHA_C0311
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.00E-60, Aligned region: 11..163
Protein Sequence: 180 a.a.     [Download]
>gi|194450746|ref|YP_002044256.1| type VI secretion protein, family [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476]
MAINNSAQKFIARNRAPRVQIEYDVEIYGSEKKIELPFVMAVLADLAGKPREELPPVTDRKFLDIDIDNF
NERMKAIAPRVAFAVPNTLTGEGQLMVDITLENMDDFSPAQIARKVDALNQLLEARTQLANLQTYMDGKA
GAENLVNKLLQDPTLLKTLANAPKPAATQQGVSADNESAE
 
Nucleotide Sequence: 543 bp     [Download]
>gi|194447306|ref|NC_011083.1|:321700-322242 Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 chromosome, complete genome
ATGGCTATCAACAATAGCGCGCAGAAATTCATCGCGCGCAACCGCGCGCCGCGCGTGCAGATTGAATATG
ACGTAGAGATTTACGGTTCCGAGAAAAAAATCGAGCTGCCGTTCGTGATGGCGGTGCTGGCCGATCTGGC
CGGGAAACCGCGTGAAGAACTGCCGCCGGTGACGGATCGCAAATTCCTCGATATTGATATTGATAACTTC
AATGAGCGCATGAAAGCCATTGCGCCGCGCGTGGCGTTCGCTGTGCCGAATACGCTGACGGGTGAAGGTC
AGTTGATGGTCGATATCACGCTGGAAAATATGGACGACTTTTCGCCGGCACAGATTGCCCGCAAGGTGGA
CGCCCTGAACCAGTTACTGGAAGCCCGCACCCAACTGGCGAACCTCCAGACCTACATGGATGGTAAGGCC
GGGGCGGAAAATCTGGTCAATAAACTGTTGCAGGACCCGACCCTGCTGAAAACGCTGGCGAATGCGCCGA
AACCGGCCGCTACCCAGCAAGGTGTGTCAGCGGATAATGAATCAGCGGAATAA