SecReT6
Protein ID: 194734344
SecReT6 ID295
T6SS typei3
Gene symbol-
Locus tagSeSA_A0308
StrainSalmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633
Repliconchromosome [GenBank: NC_011094] [Browse all T6SS(s) in this replicon]
Location [Strand]319255..319740 [+]
Producthemolysin-coregulated protein
NoteTssD
UniProt IDB4TYI4
KEGG IDsew:SeSA_A0308
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.80E-41, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|194734344|ref|YP_002113294.1| hemolysin-coregulated protein [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633]
MAYDIFLKIDGIDGESMDDKHKNEIEVLSWRWNIHQESTMHAGSGLGSGKVSVTNLDFDHYIDRASPNLF
KYCASGKHIPQAILVMRKAGGNPLEYLKYTFTDLIVAVVSPSGSHNGEIASRETVELSFSTVKQEYVVQN
QQGGSGGTITAGYDFKANKEI
 
Nucleotide Sequence: 486 bp     [Download]
>gi|194733902|ref|NC_011094.1|:319255-319740 Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633 chromosome, complete genome
ATGGCTTATGACATTTTTTTGAAAATTGACGGCATTGATGGCGAGTCAATGGATGACAAACACAAAAATG
AAATTGAAGTACTGAGCTGGCGCTGGAATATCCATCAGGAATCCACCATGCACGCCGGTAGCGGCCTCGG
CTCCGGTAAGGTCTCCGTCACCAACCTGGATTTTGATCACTATATCGACCGCGCCAGCCCGAACCTGTTC
AAATACTGCGCCTCCGGCAAGCACATTCCGCAGGCCATTCTGGTTATGCGTAAGGCTGGCGGCAATCCGC
TGGAGTACCTCAAGTATACCTTCACCGACCTGATTGTCGCCGTGGTTTCCCCGAGCGGCAGCCACAATGG
TGAAATCGCCTCCCGTGAAACGGTAGAGCTTTCTTTCAGCACCGTGAAGCAGGAATACGTGGTGCAGAAC
CAGCAGGGCGGCAGCGGCGGCACTATCACCGCAGGTTACGACTTCAAGGCGAACAAAGAAATTTAA