SecReT6
Protein ID: 194734402
SecReT6 ID295
T6SS typei3
Gene symbol-
Locus tagSeSA_A0310
StrainSalmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633
Repliconchromosome [GenBank: NC_011094] [Browse all T6SS(s) in this replicon]
Location [Strand]320516..320887 [+]
Productperiplasmic protein
NoteSTM0278 (i)
UniProt IDB4TYI6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 123 a.a.     [Download]
>gi|194734402|ref|YP_002113296.1| periplasmic protein [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633]
MKWLILVTFSISGMLVWQPSFAQEALTTQYSQSELLKNWALSHCLALVYKDDVVKNDARATASAYLEYGK
QSVEIYHEIDEIAKKYSGLKYNGSISSDFNTMKCIDFIHDSELNELIERRVEK
 
Nucleotide Sequence: 372 bp     [Download]
>gi|194733902|ref|NC_011094.1|:320516-320887 Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633 chromosome, complete genome
ATGAAATGGTTAATATTAGTTACTTTCAGCATAAGTGGAATGCTGGTATGGCAGCCATCTTTTGCACAAG
AAGCATTGACCACACAATATTCACAGTCGGAACTCTTAAAAAATTGGGCGCTGAGTCATTGTCTGGCATT
AGTATACAAAGATGATGTCGTTAAAAACGATGCCAGAGCTACGGCCAGTGCTTACCTTGAATATGGTAAA
CAATCTGTGGAGATTTATCATGAAATTGATGAGATTGCGAAAAAATATTCAGGGTTGAAATATAATGGCT
CGATATCATCAGATTTTAATACCATGAAGTGCATAGATTTTATCCACGACAGTGAGTTAAATGAATTAAT
TGAAAGGCGTGTCGAGAAGTAA