SecReT6
Protein ID: 194734614
SecReT6 ID295
T6SS typei3
Gene symbolclpV
Locus tagSeSA_A0303
StrainSalmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633
Repliconchromosome [GenBank: NC_011094] [Browse all T6SS(s) in this replicon]
Location [Strand]313193..315856 [+]
Producttype VI secretion ATPase, ClpV1 family protein
NoteTssH
UniProt IDB4TYH9
KEGG IDsew:SeSA_A0303
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.00E-39, Aligned region: 235..313
AAA_2 [PF07724], Evalue: 1.00E-39, Aligned region: 609..776
AAA [PF00004], Evalue: 3.50E-19, Aligned region: 236..368
AAA [PF00004], Evalue: 3.50E-19, Aligned region: 381..402
AAA [PF00004], Evalue: 3.50E-19, Aligned region: 615..699
AAA_5 [PF07728], Evalue: 1.10E-12, Aligned region: 236..313
AAA_5 [PF07728], Evalue: 1.10E-12, Aligned region: 614..732
ClpB_D2-small [PF10431], Evalue: 6.80E-12, Aligned region: 785..856
AAA_16 [PF13191], Evalue: 3.70E-10, Aligned region: 213..256
AAA_16 [PF13191], Evalue: 3.70E-10, Aligned region: 277..314
AAA_16 [PF13191], Evalue: 3.70E-10, Aligned region: 345..406
AAA_16 [PF13191], Evalue: 3.70E-10, Aligned region: 469..521
AAA_16 [PF13191], Evalue: 3.70E-10, Aligned region: 605..659
AAA_16 [PF13191], Evalue: 3.70E-10, Aligned region: 678..708
AAA_22 [PF13401], Evalue: 1.40E-07, Aligned region: 236..402
AAA_22 [PF13401], Evalue: 1.40E-07, Aligned region: 613..634
AAA_22 [PF13401], Evalue: 1.40E-07, Aligned region: 676..706
Sigma54_activat [PF00158], Evalue: 3.90E-06, Aligned region: 231..252
Sigma54_activat [PF00158], Evalue: 3.90E-06, Aligned region: 614..714
IstB_IS21 [PF01695], Evalue: 1.80E-05, Aligned region: 220..295
IstB_IS21 [PF01695], Evalue: 1.80E-05, Aligned region: 614..634
NACHT [PF05729], Evalue: 4.00E-05, Aligned region: 236..263
NACHT [PF05729], Evalue: 4.00E-05, Aligned region: 614..644
Zeta_toxin [PF06414], Evalue: 4.40E-05, Aligned region: 230..256
Zeta_toxin [PF06414], Evalue: 4.40E-05, Aligned region: 318..404
Zeta_toxin [PF06414], Evalue: 4.40E-05, Aligned region: 608..664
AAA_19 [PF13245], Evalue: 0.00013, Aligned region: 234..259
AAA_19 [PF13245], Evalue: 0.00013, Aligned region: 429..429
AAA_19 [PF13245], Evalue: 0.00013, Aligned region: 612..636
AAA_25 [PF13481], Evalue: 0.00013, Aligned region: 236..335
AAA_25 [PF13481], Evalue: 0.00013, Aligned region: 480..531
AAA_25 [PF13481], Evalue: 0.00013, Aligned region: 609..640
AAA_25 [PF13481], Evalue: 0.00013, Aligned region: 676..697
AAA_29 [PF13555], Evalue: 0.00033, Aligned region: 226..253
AAA_29 [PF13555], Evalue: 0.00033, Aligned region: 612..639
AAA_14 [PF13173], Evalue: 0.001, Aligned region: 235..316
AAA_14 [PF13173], Evalue: 0.001, Aligned region: 382..403
AAA_14 [PF13173], Evalue: 0.001, Aligned region: 613..696
AAA_17 [PF13207], Evalue: 0.003, Aligned region: 237..248
AAA_17 [PF13207], Evalue: 0.003, Aligned region: 614..650
AAA_18 [PF13238], Evalue: 0.005, Aligned region: 236..249
AAA_18 [PF13238], Evalue: 0.005, Aligned region: 616..647
RNA_helicase [PF00910], Evalue: 0.0059, Aligned region: 189..210
RNA_helicase [PF00910], Evalue: 0.0059, Aligned region: 237..257
RNA_helicase [PF00910], Evalue: 0.0059, Aligned region: 615..636
Hpr_kinase_C [PF07475], Evalue: 0.0095, Aligned region: 236..247
Hpr_kinase_C [PF07475], Evalue: 0.0095, Aligned region: 612..633
Protein Sequence: 887 a.a.     [Download]
>gi|194734614|ref|YP_002113289.1| type VI secretion ATPase, ClpV1 family protein [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633]
METPVSRSALYGKLAGPLFRSLESATAFCKLRSNPWVELTHWLHQLTQQPDNDILHVLRHYQIPLSDVEK
ALLRQLDMLPAGASAISDFSHHIDLSVEKAWMLASVRYGDNKIRSGWLLLALLTTPELRRVLSSICAPLA
TLPVDELTEILPSLIETSPEAQERPYDGSGLASTIPGESSQAIPNGGQDGKSALAKYCQDMTAQARDGKI
DPVTGREHEIRTMTDILLRRRQKNPLLTGEAGVGKTAVVEGFALAIAQGEVPPALREVRLLALDVGALLA
GASMKGEFESRLKGLLEEAGRSPQPVILFVDEVHTLVGAGGASGTGDAANLLKPALARGTLRTIGATTWS
EYKRHIEKDPALTRRFQVLQIAEPEEIPAMEMVRGLVDTLEKHHNVLILDEAVRAAVQLSHRYIPARQLP
DKAISLLDTAAARVALTLHTPPASVQFLRQQLKAAEMERSLLQKQEKMGIQSDERRDALMARIFSLNNEL
TASESRWQRELELVHTLQELRVAESDADDKTTLQQAETALREWQGDAPVVFPEVSAAVVAAIVADWTGIP
AGRMVKDEASQVLELPARLAQRVTGQDGALAQIGERIQTARAGLGDPRKPVGVFMLAGPSGVGKTETALA
LAEAIYGGEQNLVTINMSEFQEAHTVSTLKGAPPGYVGYGEGGVLTEAVRRHPWSVVLLDEIEKAHHDVH
ELFYQVFDKGGMEDGEGTHVDFKNTTLLLTTNVGSDLISQMCEDPALMPDATGLKEALMPELRKHFPAAF
LGRVTVIPYLPLDETSRGVIARLHLDRLVARMGEQHGVTLTYSEELVAHIVACCPMHETGARLLIGYIEQ
HILPRLSRYWLQAMTEKAAIRQIDIGVNGDEQIVFETTSQEGICQKS
 
Nucleotide Sequence: 2664 bp     [Download]
>gi|194733902|ref|NC_011094.1|:313193-315856 Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633 chromosome, complete genome
ATGGAAACTCCTGTTTCACGCAGTGCGTTGTATGGAAAACTGGCCGGCCCACTATTCCGGTCGCTGGAAT
CGGCAACGGCATTTTGCAAACTACGCTCTAATCCCTGGGTTGAGCTGACTCACTGGCTGCACCAGTTAAC
ACAGCAGCCCGATAACGATATTCTCCACGTTCTTCGGCATTACCAGATCCCTCTTTCTGATGTGGAGAAA
GCGTTACTCCGGCAACTGGATATGCTGCCCGCCGGGGCCAGCGCCATTAGTGATTTTTCTCACCATATCG
ATCTCAGCGTTGAAAAGGCCTGGATGCTGGCGAGCGTCCGTTACGGCGATAACAAAATTCGCAGCGGCTG
GTTGCTGCTGGCCTTGTTGACCACGCCAGAACTGCGTCGGGTACTGAGCAGTATCTGCGCGCCGCTGGCC
ACGCTTCCGGTTGATGAACTGACTGAAATACTGCCCTCGTTGATCGAAACATCGCCGGAAGCGCAGGAGC
GCCCTTACGACGGCTCCGGCCTGGCATCAACCATTCCCGGTGAAAGCAGTCAGGCGATTCCCAACGGCGG
GCAGGACGGTAAATCCGCGTTGGCGAAATACTGTCAGGACATGACGGCACAGGCGCGCGACGGCAAAATC
GACCCGGTGACGGGGCGTGAGCATGAAATCCGCACCATGACGGATATTCTGCTGCGCCGTCGCCAGAAAA
ATCCACTACTGACTGGTGAGGCGGGCGTCGGAAAGACGGCGGTCGTTGAAGGTTTTGCCCTCGCGATTGC
GCAGGGAGAAGTGCCGCCCGCGCTGCGGGAAGTACGGCTGCTGGCGCTGGACGTTGGCGCTCTGTTGGCC
GGAGCCAGCATGAAAGGCGAGTTTGAATCGCGTCTGAAAGGGTTACTGGAAGAGGCCGGGCGCTCGCCGC
AGCCGGTTATTCTGTTTGTCGATGAAGTTCACACTCTGGTGGGCGCGGGCGGCGCATCCGGCACGGGCGA
TGCCGCTAACCTGCTGAAACCGGCGCTGGCGCGCGGCACCCTGCGGACTATCGGCGCCACCACCTGGAGC
GAATACAAGCGCCATATTGAGAAAGATCCGGCGCTGACCCGGCGTTTTCAGGTGTTGCAGATTGCCGAAC
CGGAAGAAATCCCCGCAATGGAAATGGTGCGTGGTCTGGTGGATACGCTGGAAAAACACCATAACGTACT
GATTCTGGATGAGGCGGTACGTGCGGCGGTACAGCTTTCTCACCGCTACATTCCCGCCCGGCAGTTGCCG
GATAAGGCCATCAGCCTGCTGGATACCGCCGCGGCCCGCGTGGCGCTGACGCTGCACACGCCGCCTGCCA
GCGTACAGTTCCTGCGCCAGCAGCTAAAAGCGGCGGAAATGGAACGGTCGCTGTTGCAGAAGCAGGAAAA
AATGGGGATTCAGTCAGATGAGCGGCGCGATGCGCTGATGGCGCGAATTTTCTCGCTCAACAATGAACTG
ACTGCATCCGAATCCCGCTGGCAGCGGGAGCTGGAACTGGTACATACGTTGCAGGAACTGCGTGTCGCAG
AGTCTGATGCTGATGACAAAACCACGCTGCAACAGGCCGAAACGGCGCTAAGGGAGTGGCAGGGCGACGC
GCCGGTGGTGTTCCCGGAAGTCAGCGCGGCGGTTGTCGCGGCGATTGTCGCCGACTGGACCGGTATTCCT
GCCGGGCGCATGGTGAAAGATGAGGCCAGCCAGGTGCTGGAACTGCCTGCCCGACTGGCGCAACGCGTTA
CCGGGCAAGACGGCGCGCTGGCGCAGATTGGTGAACGTATTCAGACCGCCAGGGCGGGACTGGGCGATCC
ACGCAAACCGGTGGGCGTGTTTATGCTGGCCGGGCCGTCCGGTGTCGGTAAAACCGAAACCGCGCTGGCG
CTGGCGGAGGCTATCTACGGCGGCGAGCAGAACCTGGTAACCATCAATATGAGCGAGTTCCAGGAGGCTC
ACACCGTTTCCACGCTGAAAGGCGCGCCGCCCGGCTATGTGGGCTATGGCGAGGGTGGTGTGCTGACGGA
AGCGGTGCGTCGCCACCCCTGGAGCGTAGTGCTGCTCGACGAGATCGAAAAAGCGCACCATGACGTCCAT
GAACTCTTCTATCAGGTGTTTGACAAGGGTGGGATGGAGGACGGCGAGGGTACACATGTCGATTTCAAAA
ACACCACGCTATTACTCACCACCAACGTGGGTTCCGACCTCATCAGCCAGATGTGTGAAGATCCGGCTTT
AATGCCCGATGCTACGGGGCTTAAAGAGGCGCTAATGCCGGAATTACGCAAGCATTTCCCGGCGGCATTT
CTGGGCCGCGTGACGGTGATCCCTTACCTGCCGCTGGACGAAACGTCGCGTGGCGTGATTGCCCGTCTGC
ACCTTGACCGGCTGGTGGCGCGGATGGGTGAACAGCACGGCGTGACGCTGACGTATAGCGAGGAACTGGT
CGCACATATTGTAGCGTGCTGTCCAATGCATGAAACGGGCGCGCGGTTGCTGATTGGCTACATCGAACAG
CACATCCTGCCACGACTGTCGCGCTACTGGTTGCAGGCCATGACGGAAAAAGCCGCTATCAGGCAGATTG
ATATCGGCGTTAATGGTGATGAGCAGATTGTTTTTGAGACAACCTCGCAGGAGGGAATATGCCAAAAGAG
TTAA